Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VacA, Helicobacter pylori (His)

The VacA protein takes center stage, demonstrating its unique ability to induce vacuole formation in eukaryotic cells, affecting cell morphology. This process involves the formation of vacuoles, highlighting the role of VacA as a key regulator of cell structure. vacA Protein, Helicobacter pylori (His) is the recombinant vacA protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

VacA Protein, Helicobacter pylori (His), Others, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/vaca-protein-helicobacter-pylori-his.html

Purity

98.0

Smiles

TTVIIPAIVGGIATGAAVGTVSGLLGWGLKQAEEANKTPDKPDKVWRIQAGKGFNEFPNKEYDLYRSLLSSKIDGGWDWGNAATHYWVKGGQWNKLEVDMKDAVGTYNLSGLRNFTGGDLDVNMQKATLRLGQFNGNSFTSYKDSADRTTRVDFNAKNILIDNFLEINNRVGSGAGRKASSTVLTLQASEGITSSKNAEISLYDGATLN

Molecular Formula

/ (Gene_ID) P55981 (T37-N245) (Accession)

Molecular Weight

Approximately 25-26.6 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SIGLEC6 (NM_001177548) Human Over-expression Lysate
LC432981 20 µg

SIGLEC6 (NM_001177548) Human Over-expression Lysate

Sign In for Pricing
View Details
ROMK/Kir1.1 (Ab-44/25) Antibody
8B1121-AAT 50 µg

ROMK/Kir1.1 (Ab-44/25) Antibody

Sign In for Pricing
View Details
Arf1 Mouse Gene Knockout Kit (CRISPR)
KN501469 1 Kit

Arf1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant Human GADD45A protein (His tag)
PDEH100957-01 20 µg

Recombinant Human GADD45A protein (His tag)

Sign In for Pricing
View Details
Recombinant Human GADD45A protein (His tag)
PDEH100957-02 100 µg

Recombinant Human GADD45A protein (His tag)

Sign In for Pricing
View Details
Recombinant Human GADD45A protein (His tag)
PDEH100957-03 500 µg

Recombinant Human GADD45A protein (His tag)

Sign In for Pricing
View Details