Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-17A, Human

IL-17A is a homodimeric cytokine and plays a critical role in host defense mechanisms against many bacterial and fungal pathogens as well as allergic and autoimmune responses. IL-17A induces the production of antimicrobial peptides, cytokines, chemokines, and matrix metalloproteinases[1][2]. IL-17A Protein, Human is a recombinant human IL-17A protein and is expressed in E. coli. It consists of 137 amino acids (I19-A155) .

Product Specifications

Product Name Alternative

IL-17A Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-17a-protein-human.html

Purity

98.0

Smiles

GITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVA

Molecular Formula

3605 (Gene_ID) Q16552 (G24-A155) (Accession)

Molecular Weight

Approximately 16-17 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Chen K, et al. Interluekin-17A (IL17A) . Gene. 2017 May 30;614:8-14.|[2]Iwakura Y, et al. The roles of IL-17A in inflammatory immune responses and host defense against pathogens. Immunol Rev. 2008 Dec;226:57-79.|[3]Cua DJ, et al. Innate IL-17-producing cells: the sentinels of the immune system. Nat Rev Immunol. 2010 Jul;10 (7) :479-89.|[4]Wright JF, et al. The human IL-17F/IL-17A heterodimeric cytokine signals through the IL-17RA/IL-17RC receptor complex. J Immunol. 2008 Aug 15;181 (4) :2799-805.|[5]Kinoshita H, et al. Cytokine milieu modulates release of thymic stromal lymphopoietin from human keratinocytes stimulated with double-stranded RNA. J Allergy Clin Immunol. 2009 Jan;123 (1) :179-86.|[6]Henness S, et al. IL-17A acts via p38 MAPK to increase stability of TNF-alpha-induced IL-8 mRNA in human ASM. Am J Physiol Lung Cell Mol Physiol. 2006 Jun;290 (6) :L1283-90.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C10orf28 Protein Vector (Human) (pPB-C-His)
PV049457 500 ng

C10orf28 Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
Phospho-RSK2 (Ser227) Rabbit mAb
C05502-20uL 20 µL

Phospho-RSK2 (Ser227) Rabbit mAb

Sign In for Pricing
View Details
Recombinant Bacteroides fragilis Pyridoxine/pyridoxamine 5'-phosphate oxidase (pdxH)
MBS1304447-01 0.02 mg (E-Coli)

Recombinant Bacteroides fragilis Pyridoxine/pyridoxamine 5'-phosphate oxidase (pdxH)

Sign In for Pricing
View Details
Recombinant Bacteroides fragilis Pyridoxine/pyridoxamine 5'-phosphate oxidase (pdxH)
MBS1304447-02 0.1 mg (E-Coli)

Recombinant Bacteroides fragilis Pyridoxine/pyridoxamine 5'-phosphate oxidase (pdxH)

Sign In for Pricing
View Details
Recombinant Bacteroides fragilis Pyridoxine/pyridoxamine 5'-phosphate oxidase (pdxH)
MBS1304447-03 0.02 mg (Baculovirus)

Recombinant Bacteroides fragilis Pyridoxine/pyridoxamine 5'-phosphate oxidase (pdxH)

Sign In for Pricing
View Details
Recombinant Bacteroides fragilis Pyridoxine/pyridoxamine 5'-phosphate oxidase (pdxH)
MBS1304447-04 0.02 mg (Mammalian-Cell)

Recombinant Bacteroides fragilis Pyridoxine/pyridoxamine 5'-phosphate oxidase (pdxH)

Sign In for Pricing
View Details