Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Amaranthus caudatus Antimicrobial peptide 2

Product Specifications

Product Name Alternative

(AMP2) (AMP1)

Abbreviation

Recombinant Amaranthus caudatus Antimicrobial peptide 2 protein

UniProt

P27275

Expression Region

26-55aa

Organism

Amaranthus caudatus (Love-lies-bleeding) (Inca-wheat)

Target Sequence

VGECVRGRCPSGMCCSQFGYCGKGPKYCGR

Tag

N-terminal 6xHis-KSI-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Others

Relevance

Chitin-binding protein with a defensive function against numerous chitin containing fungal pathogens. It is also a potent inhibitor of Gram-positive bacteria.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

18.5 kDa

References & Citations

"NMR investigations of protein-carbohydrate interactions: studies on the relevance of Trp/Tyr variations in lectin binding sites as deduced from titration microcalorimetry and NMR studies on hevein domains. Determination of the NMR structure of the complex between pseudohevein and N, N', N"-triacetylchitotriose." Asensio J.L., Siebert H.C., von Der Lieth C.W., Laynez J., Bruix M., Soedjanaamadja U.M., Beintema J.J., Canada F.J., Gabius H.J., Jimenez-Barbero J. Proteins 40:218-236 (2000)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Lentiviral human KRTAP20-2 sgRNA gene knockout kit - Lentiviral human KRTAP20-2 sgRNA gene knockout kit (25)
GTR15370995 1 Vial

Lentiviral human KRTAP20-2 sgRNA gene knockout kit - Lentiviral human KRTAP20-2 sgRNA gene knockout kit (25)

Ask
View Details
B7-H5/Gi24/VSIR Protein (C-His, Human)
P513396 100 µg

B7-H5/Gi24/VSIR Protein (C-His, Human)

Ask
View Details
Recombinant Campylobacter jejuni subsp. jejuni serotype O:2 Putative Holliday junction resolvase (Cj0635)
MBS1330050-01 0.02 mg (E-Coli)

Recombinant Campylobacter jejuni subsp. jejuni serotype O:2 Putative Holliday junction resolvase (Cj0635)

Ask
View Details
Recombinant Campylobacter jejuni subsp. jejuni serotype O:2 Putative Holliday junction resolvase (Cj0635)
MBS1330050-02 0.1 mg (E-Coli)

Recombinant Campylobacter jejuni subsp. jejuni serotype O:2 Putative Holliday junction resolvase (Cj0635)

Ask
View Details
Recombinant Campylobacter jejuni subsp. jejuni serotype O:2 Putative Holliday junction resolvase (Cj0635)
MBS1330050-03 0.02 mg (Yeast)

Recombinant Campylobacter jejuni subsp. jejuni serotype O:2 Putative Holliday junction resolvase (Cj0635)

Ask
View Details
Recombinant Campylobacter jejuni subsp. jejuni serotype O:2 Putative Holliday junction resolvase (Cj0635)
MBS1330050-04 0.1 mg (Yeast)

Recombinant Campylobacter jejuni subsp. jejuni serotype O:2 Putative Holliday junction resolvase (Cj0635)

Ask
View Details