Serpin A6, Mouse (HEK293, His)
Serpin A6 Protein serves as the primary transport protein for glucocorticoids and progestins in the blood of nearly all vertebrate species. Serpin A6 Protein, Mouse (HEK293, His) is the recombinant mouse-derived Serpin A6 protein, expressed by HEK293 , with C-His labeled tag.
Product Specifications
Product Name Alternative
Serpin A6 Protein, Mouse (HEK293, His), Mouse, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/serpin-a6-protein-mouse-hek293-his.html
Purity
98.0
Smiles
VTDEDSSSHRDLAPTNVDFAFNLYKRLVALNSDKNTLISPVSISMALAMLSLSTRGSTQYLENLGFNMSKMSEAEIHQGFQYLNSLLQQSDTGLEMNMGNVMFLLQNLKLKDSFLADTKHYYESEALTIPSKDWTKAGEQINNHVKNKTQGKIEHVVSDLDSSATLILINYIFLKGIWKLPFSPENTREEDFYVNETSTVKVPMMVQSGNISYFRDSAIPCQMVQMNYVGNGTTFIILPDQGQMDTVVAALNRDTIDRWGKLMIPRQMNLYIPKFSMSDTYDLQDVLADVGIKDLFTNQSDFADTTKDTPLTLTVLHKAMLQLDEGNVLPAATNGPPVHLPSESFTLKYNRPFIFLAFDKYTWSSLMMSQVMNPA
Molecular Formula
12401 (Gene_ID) Q06770 (V23-A397) (Accession)
Molecular Weight
Approximately 50-80 kDa due to the glycosylation
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
orb2922675-01 20 µg
Recombinant Brassica oleracea Ethylene receptor 1 (ETR1)
Sign In for Pricing
View Details orb2922675-02 100 µg
Recombinant Brassica oleracea Ethylene receptor 1 (ETR1)
Sign In for Pricing
View Details 
ELI-51764h 96 Tests
Human TM2 domain-containing protein 1, TM2D1 ELISA KIT
Sign In for Pricing
View Details