Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SUMO-Star (recombinant human SUMO protease), His tag

Product Specifications

Overview

SUMO star (R64T, R71E) protease, also known as ULP protease, is a cysteine protease with high activity. SUMO proteases cleave proteins with a very high specificity. It can specifically recognize the tertiary structure of UBL proteins, namely Small Ubiquitin-LikeModifier (SUMO), rather than the amino acid sequence. The optimal reaction temperature was 30°C, and the enzyme acted in a wide range of temperature and pH (pH7-9) . SUMO Star for mammalian expression protein, this protease recognizes tertiary structure of SUMO tag: LQDSEVNQEAKPEVKPEVKPETHINLKVSDGSSEIFFKIKKTTPLRRLMEAFAKRQGKEMDSLTFLYDGIEIQADQTPEDLDMEDNDIIEAHREQIGG↓XX (Except P on first X) We have directional protein refolding technology (LeaBioFOLD) and self-developed technology platforms for proteins covering screening and purification, engineering design, fixed-point coupling design, and dosage form development. Protein refolding is a process of recovering protein aggregates in inclusion bodies in the form of misfolded and inactive proteins expressed by prokaryotes such as Escherichia coli back into proteins with correct conformation and bioactivity under appropriate conditions in vitro. It is a key technology for biopharmaceutical companies but a major bottleneck in protein production in prokaryotic expression systems. Leading Biology has been specializing in protein refolding for many years, has a core team with over ten years of experience in this technology and rich experience in its industrialization. Our team is summarizing the experience to form an independent technological system of ours.

Synonyms

SUMOstar protease

Expression System

E.coli

Tag

N-His

Endotoxin

< 1.0 EU per μg of the protein as determined by the LAL method.

Purity

> 95% as determined by SDS-PAGE.

Length

228

Form

Liquid

Buffer

PBS

Molecular Weight

26.4 kDa

Storage Conditions

Stable for 1 year at -20°C or below from date of shipment. For maximum recovery of product, centrifuge the original vial after thawing and opening the cap. For long-term storage, aliquot and store at -20°C or below. Avoid repeated freeze-thaw cycles.

Symbol

SUMOstar

Species

Human

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Porcine Interleukin 8 (IL8) Antibody Pair Kit (with Standard)
MBS2089683-01 5x 96 Tests

Porcine Interleukin 8 (IL8) Antibody Pair Kit (with Standard)

Ask
View Details
Porcine Interleukin 8 (IL8) Antibody Pair Kit (with Standard)
MBS2089683-02 5x 96 Tests + MBS2090685 (Ab Pairs Support Pack 1,5x 96 Tests)

Porcine Interleukin 8 (IL8) Antibody Pair Kit (with Standard)

Ask
View Details
Porcine Interleukin 8 (IL8) Antibody Pair Kit (with Standard)
MBS2089683-03 10x 96 Tests

Porcine Interleukin 8 (IL8) Antibody Pair Kit (with Standard)

Ask
View Details
Porcine Interleukin 8 (IL8) Antibody Pair Kit (with Standard)
MBS2089683-04 10x 96 Tests + MBS2090685 (Ab Pairs Support Pack 1, 10x 96 Tests)

Porcine Interleukin 8 (IL8) Antibody Pair Kit (with Standard)

Ask
View Details
Recombinant Brucella abortus Protein TolB (tolB)
MBS1485100-01 0.02 mg (E-Coli)

Recombinant Brucella abortus Protein TolB (tolB)

Ask
View Details
Recombinant Brucella abortus Protein TolB (tolB)
MBS1485100-02 0.02 mg (Yeast)

Recombinant Brucella abortus Protein TolB (tolB)

Ask
View Details