Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

I-309/CCL1, Human

CCL1 Protein, Human is a cytokine that mediates inflammatory immune responses, viral infections, and tumorigenesis by interacting with the CCR8 chemokine receptor on the cell surface and attracting monocytes, natural killer cells, and immature B-cell nuclear dendritic cells. I-309/CCL1 Protein, Human is a recombinant human CCL1 (K24-K96) expressed by E. coli[1].

Product Specifications

Product Name Alternative

I-309/CCL1 Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ccl1-protein-human.html

Purity

98.0

Smiles

KSMQVPFSRCCFSFAEQEIPLRAILCYRNTSSICSNEGLIFKLKRGKEACALDTVGWVQRHRKMLRHCPSKRK

Molecular Formula

6346 (Gene_ID) P22362 (K24-K96) (Accession)

Molecular Weight

Approximately 10 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]M D Miller, et al. The human cytokine I-309 is a monocyte chemoattractant. Proc Natl Acad Sci U S A. 1992 Apr 1;89 (7) :2950-4.|[2]A Zingoni, et al. The chemokine receptor CCR8 is preferentially expressed in Th2 but not Th1 cells. J Immunol. 1998 Jul 15;161 (2) :547-51.|[3]Gültekin Tamgüney, et al. Autocrine stimulation of rhadinovirus-transformed T cells by the chemokine CCL1/I-309. Oncogene. 2004 Nov 4;23 (52) :8475-85.|[4]Nasreen S Haque, et al. Chemokine receptor-8 (CCR8) mediates human vascular smooth muscle cell chemotaxis and metalloproteinase-2 secretion. Blood. 2004 Feb 15;103 (4) :1296-304.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse IgM Isotype Control
AM03111PU-N 100 µg

Mouse IgM Isotype Control

Sign In for Pricing
View Details
Anti-UBE2L6 Antibody
A07315 100 µL

Anti-UBE2L6 Antibody

Sign In for Pricing
View Details
MEGF11 Protein Vector (Mouse) (pPM-C-HA)
28333024 500 ng

MEGF11 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
Lentiviral mouse Cdc6 shRNA (UAS) - Lentiviral mouse Cdc6 shRNA (UAS) (100)
GTR15216678 1 Vial

Lentiviral mouse Cdc6 shRNA (UAS) - Lentiviral mouse Cdc6 shRNA (UAS) (100)

Sign In for Pricing
View Details
Recombinant Vaccinia virus Profilin (VACWR167)
MBS1384753-01 0.02 mg (E-Coli)

Recombinant Vaccinia virus Profilin (VACWR167)

Sign In for Pricing
View Details
Recombinant Vaccinia virus Profilin (VACWR167)
MBS1384753-02 0.1 mg (E-Coli)

Recombinant Vaccinia virus Profilin (VACWR167)

Sign In for Pricing
View Details