Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MDH1, Human (His)

Multiple studies have shown that the MDH1 protein plays a crucial role in cellular metabolism, catalyzing the reduction of aromatic α-keto acids in the presence of NADH. It plays an important role in the malate-aspartate shuttle and the tricarboxylic acid cycle, which is essential for supplying mitochondrial NADH for oxidative phosphorylation. MDH1 Protein, Human (His) is the recombinant human-derived MDH1 protein, expressed by E. coli , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

MDH1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/mdh1-protein-human-his.html

Purity

99.90

Smiles

SEPIRVLVTGAAGQIAYSLLYSIGNGSVFGKDQPIILVLLDITPMMGVLDGVLMELQDCALPLLKDVIATDKEDVAFKDLDVAILVGSMPRREGMERKDLLKANVKIFKSQGAALDKYAKKSVKVIVVGNPANTNCLTASKSAPSIPKENFSCLTRLDHNRAKAQIALKLGVTANDVKNVIIWGNHSSTQYPDVNHAKVKLQGKEVGVYEALKDDSWLKGEFVTTVQQRGAAVIKARKLSSAMSAAKAICDHVRDIWFGTPEGEFVSMGVISDGNSYGVPDDLLYSFPVVIKNKTWKFVEGLPINDFSREKMDLTAKELTEEKESAFEFLSSA

Molecular Formula

4190 (Gene_ID) P40925-1 (S2-A334) (Accession)

Molecular Weight

Approximately 37 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IL24 Recombinant Protein
OPCD04389-200UG 200 µg

IL24 Recombinant Protein

Sign In for Pricing
View Details
TEX261 (h) -PR
sc-94935-PR 10 µM - 20 µL

TEX261 (h) -PR

Sign In for Pricing
View Details
METTL21D CRISPRa sgRNA lentivector (set of three targets)(Human)
28410121 3x 1.0µg DNA

METTL21D CRISPRa sgRNA lentivector (set of three targets)(Human)

Sign In for Pricing
View Details
HoxC13 CRISPR Activation Plasmid (m2)
sc-420920-ACT-2 20 µg

HoxC13 CRISPR Activation Plasmid (m2)

Sign In for Pricing
View Details
Crlf3 (NM_018776) Mouse Recombinant Protein
TP517831 20 µg

Crlf3 (NM_018776) Mouse Recombinant Protein

Sign In for Pricing
View Details
Human MTARC1 (Mitochondrial amidoxime-reducing component 1) ELISA Kit
EH4968 96 Tests

Human MTARC1 (Mitochondrial amidoxime-reducing component 1) ELISA Kit

Sign In for Pricing
View Details