Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MDH1, Human (His)

Multiple studies have shown that the MDH1 protein plays a crucial role in cellular metabolism, catalyzing the reduction of aromatic α-keto acids in the presence of NADH. It plays an important role in the malate-aspartate shuttle and the tricarboxylic acid cycle, which is essential for supplying mitochondrial NADH for oxidative phosphorylation. MDH1 Protein, Human (His) is the recombinant human-derived MDH1 protein, expressed by E. coli , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

MDH1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/mdh1-protein-human-his.html

Purity

99.90

Smiles

SEPIRVLVTGAAGQIAYSLLYSIGNGSVFGKDQPIILVLLDITPMMGVLDGVLMELQDCALPLLKDVIATDKEDVAFKDLDVAILVGSMPRREGMERKDLLKANVKIFKSQGAALDKYAKKSVKVIVVGNPANTNCLTASKSAPSIPKENFSCLTRLDHNRAKAQIALKLGVTANDVKNVIIWGNHSSTQYPDVNHAKVKLQGKEVGVYEALKDDSWLKGEFVTTVQQRGAAVIKARKLSSAMSAAKAICDHVRDIWFGTPEGEFVSMGVISDGNSYGVPDDLLYSFPVVIKNKTWKFVEGLPINDFSREKMDLTAKELTEEKESAFEFLSSA

Molecular Formula

4190 (Gene_ID) P40925-1 (S2-A334) (Accession)

Molecular Weight

Approximately 37 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Dbndd1 (NM_028146) AAV Particle
MR216430A1V 250 µL

Mouse Dbndd1 (NM_028146) AAV Particle

Sign In for Pricing
View Details
Human neuronal nuclear autoantibody, ANNA-1/Hu ELISA Kit
YLA2296HU-01 48 Tests

Human neuronal nuclear autoantibody, ANNA-1/Hu ELISA Kit

Sign In for Pricing
View Details
Human neuronal nuclear autoantibody, ANNA-1/Hu ELISA Kit
YLA2296HU-02 96 Tests

Human neuronal nuclear autoantibody, ANNA-1/Hu ELISA Kit

Sign In for Pricing
View Details
DUSP26 Knockout HAP1 Polyclonal Cells
ARG40069 1 Million

DUSP26 Knockout HAP1 Polyclonal Cells

Sign In for Pricing
View Details
TUSC2 Antibody
MBS7044130-01 0.05 mL

TUSC2 Antibody

Sign In for Pricing
View Details
TUSC2 Antibody
MBS7044130-02 0.1 mL

TUSC2 Antibody

Sign In for Pricing
View Details