Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rickettsia typhi 17 kDa surface antigen (omp)

Product Specifications

Abbreviation

Recombinant Rickettsia typhi omp protein

Gene Name

Omp

UniProt

P22882

Expression Region

20-159aa

Organism

Rickettsia typhi (strain ATCC VR-144 / Wilmington)

Target Sequence

CNGPGGMNKQGTGTLLGGAGGALLGSQFGHGKGQLVGVGVGALLGAVLGGQIGASMDEQDRKLLELTSQRALESAPSGSNIEWRNPDNGNHGYVTPNKTYRNSTGQYCREYTQTVVIGGKQQTTYGNACRQPDGQWQVAN

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

Membrane-bound mucin, a family of highly glycosylated proteins that constitute the major component of the mucus, the slimy and viscous secretion covering epithelial surfaces. These glycoproteins play important roles in the protection of the epithelium and are implicated in epithelial renewal and differentiation. Regulates cellular behavior through both anti-adhesive effects on cell-cell and cell-extracellular matrix interactions and its ability to act as an intramembrane ligand for ERBB2. Plays an important role in proliferation and differentiation of epithelial cells by inducing specific phosphorylation of ERBB2. In polarized epithelial cells, segregates ERBB2 and other ERBB receptors and prevents ERBB2 from acting as a coreceptor. The interaction with ERBB2 leads to enhanced expression of CDKN1B. The formation of a MUC4-ERBB2-ERBB3-NRG1 complex leads to down-regulation of CDKN1B, resulting in repression of apoptosis and stimulation of proliferation. Its ability to promote tumor growth may be mainly due to repression of apoptosis as opposed to proliferation.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

22.0 kDa

References & Citations

"Functional annotation of a full-length mouse cDNA collection." Kawai J., Shinagawa A., Shibata K., Yoshino M., Itoh M., Ishii Y., Arakawa T., Hara A., Fukunishi Y., Konno H., Adachi J., Fukuda S., Aizawa K., Izawa M., Nishi K., Kiyosawa H., Kondo S., Yamanaka I. Hayashizaki Y. Nature 409:685-690 (2001)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Product MSDS

https://www.cusabio.com/msds/12934215/

Protein Length

Full Length of Mature Protein

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Human CPZ (Carboxypeptidase Z) ELISA Kit
MBS8803680-01 48 Well

Human CPZ (Carboxypeptidase Z) ELISA Kit

Ask
View Details
Human CPZ (Carboxypeptidase Z) ELISA Kit
MBS8803680-02 96 Well

Human CPZ (Carboxypeptidase Z) ELISA Kit

Ask
View Details
Human CPZ (Carboxypeptidase Z) ELISA Kit
MBS8803680-03 5x 96 Well

Human CPZ (Carboxypeptidase Z) ELISA Kit

Ask
View Details
Human CPZ (Carboxypeptidase Z) ELISA Kit
MBS8803680-04 10x 96 Well

Human CPZ (Carboxypeptidase Z) ELISA Kit

Ask
View Details
LOC388813 Double Nickase Plasmid (h2)
sc-417327-NIC-2 20 µg

LOC388813 Double Nickase Plasmid (h2)

Ask
View Details
Human Eotaxin-3/CCL26  ELISA kit
EIA05618h 96 Well

Human Eotaxin-3/CCL26  ELISA kit

Ask
View Details