Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Galectin-7 (LGALS7)

Product Specifications

Product Name Alternative

HKL-14PI7p53-induced gene 1 protein

Abbreviation

Recombinant Human LGALS7 protein

Gene Name

LGALS7

UniProt

P47929

Expression Region

2-136aa

Organism

Homo sapiens (Human)

Target Sequence

SNVPHKSSLPEGIRPGTVLRIRGLVPPNASRFHVNLLCGEEQGSDAALHFNPRLDTSEVVFNSKEQGSWGREERGPGVPFQRGQPFEVLIIASDDGFKAVVGDAQYHHFRHRLPLARVRLVEVGGDVQLDSVRIF

Tag

N-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Neuroscience

Relevance

Could be involved in cell-cell and/or cell-matrix interactions necessary for normal growth control. Pro-apoptotic protein that functions intracellularly upstream of JNK activation and cytochrome c release.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Could be involved in cell-cell and/or cell-matrix interactions necessary for normal growth control. Pro-apoptotic protein that functions intracellularly upstream of JNK activation and cytochrome c release.

Molecular Weight

18.9 kDa

References & Citations

Cloning, expression, and chromosome mapping of human galectin-7.Madsen P., Rasmussen H.H., Flint T., Gromov P., Kruse T.A., Honore B., Vorum H., Celis J.E.J. Biol. Chem. 270:5823-5829 (1995)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Rat AMPK alpha2 Protein (His Tag)
PDER100146-01 20 µg

Recombinant Rat AMPK alpha2 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Rat AMPK alpha2 Protein (His Tag)
PDER100146-02 100 µg

Recombinant Rat AMPK alpha2 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Rat AMPK alpha2 Protein (His Tag)
PDER100146-03 500 µg

Recombinant Rat AMPK alpha2 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Rat AMPK alpha2 Protein (His Tag)
PDER100146-04 1 mg

Recombinant Rat AMPK alpha2 Protein (His Tag)

Sign In for Pricing
View Details
CD9 (TSPAN29) (Motility-Related Protein-1) (P1/33/2), CF740 conjugate, 0.1mg/mL
BNC742218-100 1x 100 µL

CD9 (TSPAN29) (Motility-Related Protein-1) (P1/33/2), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Clethodim
TRC-C573250-250MG 250 mg

Clethodim

Sign In for Pricing
View Details