Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PSMD4 Antibody - N-terminal region : Biotin (ARP58060_P050-Biotin)

Product Specifications

Gene Name

Proteasome (prosome, macropain) 26S subunit, non-ATPase, 4

Gene Aliases

AF, ASF, S5A, AF-1, MCB1, Rpn10, pUB-R5

Gene ID

5710

Swiss Prot

P55036

Accession Number

NP_002801

Host

Rabbit

Reactivity

Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep, Yeast, Zebrafish

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human PSMD4

Target

The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 20S core is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. The 19S regulator is composed of a base, which contains 6 ATPase subunits and 2 non-ATPase subunits, and a lid, which contains up to 10 non-ATPase subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. PSMD4 encodes one of the non-ATPase subunits of the 19S regulator lid. The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 20S core is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. The 19S regulator is composed of a base, which contains 6 ATPase subunits and 2 non-ATPase subunits, and a lid, which contains up to 10 non-ATPase subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes one of the non-ATPase subunits of the 19S regulator lid. Pseudogenes have been identified on chromosomes 10 and 21. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Partner Proteins

UBC; cdc20; XPC; SPRTN; PSMD14; MDM2; PSMC2; PSMA1; ADRM1; UBQLN1; TXNL1; PSMD3; PSMD2; PSMD1; PSMC6; PSMC4; PSMC1; UCHL5; RPS12; PSMD8; UBQLN4; VCP; GJA1; DIO2; SCHIP1; FBXO6; PARK2; UL76; FBXO25; LOC100044627; Gm4705; LOC677113; Rps6-ps4; Rpl34-ps1; Rpl

Clonality

Polyclonal

Conjugation

Biotin

Type

Polyclonal Antibody

Applications

WB

Purification

Affinity Purified

Sample Type

PSMD4 is supported by BioGPS gene expression data to be expressed in Jurkat

Concentration

0.5 mg/ml

Homology

Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Yeast: 92%; Zebrafish: 100%

Format

Liquid. Purified antibody supplied in 1x PBS buffer.

Reconstitution

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Molecular Weight

41kDa

References & Citations

Elangovan, M., (2007) Biochem. Biophys. Res. Commun. 364 (2), 226-230

Shipping Conditions

Wet Ice

Protein Length

377

NCBI Gene Symbol

PSMD4

NCBI GB Accession Number

PSMD4

Host or Source

Rabbit

Protein Name

26S proteasome non-ATPase regulatory subunit 4

Nucleotide Accession Number

NM_002810

Peptide Sequence

VLESTMVCVDNSEYMRNGDFLPTRLQAQQDAVNIVCHSKTRSNPENNVGL

Subunit

4

More Discoveries

Explore Other Products

Browse additional items from our catalog

Olr609 (NM_001000335) Rat Tagged ORF Clone Lentiviral Particle
RR203655L4V 200 µL

Olr609 (NM_001000335) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Recombinant Rat LPP Protein, His (Fc)-Avi-tagged
LPP-3100R 50 µg

Recombinant Rat LPP Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details
Mouse Hacl1 (NM_019975) AAV Particle
MR209103A1V 250 µL

Mouse Hacl1 (NM_019975) AAV Particle

Sign In for Pricing
View Details
Rabbit Polyclonal CD98 Antibody [DyLight 594]
NBP2-32221DL594 0.1 mL

Rabbit Polyclonal CD98 Antibody [DyLight 594]

Sign In for Pricing
View Details
Parainfluenza Virus Type 3 (Biotin)
P3107-27B 1 mL

Parainfluenza Virus Type 3 (Biotin)

Sign In for Pricing
View Details
LHFPL1, NT (LHFPL1, Lipoma HMGIC fusion partner-like 1 protein) (MaxLight 405)
MBS6315948-01 0.1 mL

LHFPL1, NT (LHFPL1, Lipoma HMGIC fusion partner-like 1 protein) (MaxLight 405)

Sign In for Pricing
View Details