Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MBP Antibody - middle region : FITC (ARP56224_P050-FITC)

Product Specifications

Gene Name

Myelin basic protein

Gene Aliases

MGC99675

Gene ID

4155

Swiss Prot

P02686

Accession Number

NP_001020272

Host

Rabbit

Reactivity

Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human MBP

Target

The classic group of MBP isoforms (isoform 4-isoform 14) are with PLP the most abundant protein components of the myelin membrane in the CNS. They have a role in both its formation and stabilization. The smaller isoforms might have an important role in remyelination of denuded axons in multiple sclerosis. The non-classic group of MBP isoforms (isoform 1-isoform 3/Golli-MBPs) may preferentially have a role in the early developing brain long before myelination, maybe as components of transcriptional complexes, and may also be involved in signaling pathways in T-cells and neural cells. Differential splicing events combined with optional post-translational modifications give a wide spectrum of isomers, with each of them potentially having a specialized function. MBP induces T-cell proliferation.The protein encoded by the classic MBP gene is a major constituent of the myelin sheath of oligodendrocytes and Schwann cells in the nervous system. However, MBP-related transcripts are also present in the bone marrow and the immune system. These mRNAs arise from the long MBP gene (otherwise called 'Golli-MBP') that contains 3 additional exons located upstream of the classic MBP exons. Alternative splicing from the Golli and the MBP transcription start sites gives rise to 2 sets of MBP-related transcripts and gene products. The Golli mRNAs contain 3 exons unique to Golli-MBP, spliced in-frame to 1 or more MBP exons. They encode hybrid proteins that have N-terminal Golli aa sequence linked to MBP aa sequence. The second family of transcripts contain only MBP exons and produce the well characterized myelin basic proteins. This complex gene structure is conserved among species suggesting that the MBP transcription unit is an integral part of the Golli transcription unit and that this arrangement is important for the function and/or regulation of these genes.

Partner Proteins

CTDSP1; MAP3K3; UBC; PRKCB; MAPK3; MAPK1; ULK1; SQSTM1; PKN1; HIPK2; MNAT1; CDK9; CDK8; CDK7; CCNT1; CCNH; CCNC; MELK; DDX58; MAPK14; AT4G38520; AT4G31860; AT4G28400; ABI1; RPS6KA6; TOPP8; AT5G24940; AT5G10740; AT5G06750; AT3G17250; AT3G02750; AT3G15260

Clonality

Polyclonal

Conjugation

FITC: Fluorescein Isothiocyanate

Type

Polyclonal Antibody

Applications

IHC, IP, WB

Purification

Affinity Purified

Concentration

0.5 mg/ml

Homology

Cow: 80%; Dog: 87%; Guinea Pig: 79%; Horse: 80%; Human: 100%; Mouse: 93%; Pig: 80%; Rabbit: 93%; Rat: 87%

Format

Liquid. Purified antibody supplied in 1x PBS buffer.

Reconstitution

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Molecular Weight

33kDa

References & Citations

Zhang, Q.Y., (2008) Arch. Med. Res. 39 (1), 45-51

Shipping Conditions

Wet Ice

Protein Length

304

NCBI Gene Symbol

MBP

NCBI GB Accession Number

MBP

Host or Source

Rabbit

Protein Name

Myelin basic protein

Nucleotide Accession Number

NM_001025101

Peptide Sequence

FGGDRGAPKRGSGKDSHHPARTAHYGSLPQKSHGRTQDENPVVHFFKNIV

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Tumor Necrosis Factor Receptor Superfamily Member 13B / CD267 (TNFRSF13B) Protein
abx655850-01 100 µg

Human Tumor Necrosis Factor Receptor Superfamily Member 13B / CD267 (TNFRSF13B) Protein

Sign In for Pricing
View Details
Human Tumor Necrosis Factor Receptor Superfamily Member 13B / CD267 (TNFRSF13B) Protein
abx655850-02 200 µg

Human Tumor Necrosis Factor Receptor Superfamily Member 13B / CD267 (TNFRSF13B) Protein

Sign In for Pricing
View Details
Human Tumor Necrosis Factor Receptor Superfamily Member 13B / CD267 (TNFRSF13B) Protein
abx655850-03 500 µg

Human Tumor Necrosis Factor Receptor Superfamily Member 13B / CD267 (TNFRSF13B) Protein

Sign In for Pricing
View Details
Human Tumor Necrosis Factor Receptor Superfamily Member 13B / CD267 (TNFRSF13B) Protein
abx655850-04 1 mg

Human Tumor Necrosis Factor Receptor Superfamily Member 13B / CD267 (TNFRSF13B) Protein

Sign In for Pricing
View Details
FOXB1 Lentiviral Vector (Rat) (EF1a) (pLenti-GIII-EF1a)
LV634464 1.0 µg DNA

FOXB1 Lentiviral Vector (Rat) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details
Anti-Granzyme A Antibody
MBS8248070-01 0.03 mL

Anti-Granzyme A Antibody

Sign In for Pricing
View Details