Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RPS7 Antibody - middle region : Biotin (ARP56148_P050-Biotin)

Product Specifications

Gene Name

Ribosomal protein S7

Gene Aliases

S7, eS7, DBA8

Gene ID

6201

Swiss Prot

P62081

Accession Number

NP_001002

Host

Rabbit

Reactivity

Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Yeast, Zebrafish

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human RPS7

Target

RPS7 is required for rRNA maturation.Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 40S subunit. The protein belongs to the S7E family of ribosomal proteins. It is located in the cytoplasm. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Partner Proteins

RPS3; MDM2; HUWE1; ZBTB14; UBC; TP53; CEP76; TUBGCP3; CEP57; CDC37L1; RPA3; RPA2; RPA1; RNF2; EED; FAU; DDX3X; PSMC4; WIBG; EIF2A; WDR26; PNO1; TSR1; RPS27L; RPS29; RPS28; RPS27; RPS26; RPS25; RPS24; RPS23; RPS20; RPS19; RPS18; RPS16; RPS15A; RPS14; RPS13

Clonality

Polyclonal

Conjugation

Biotin

Type

Polyclonal Antibody

Applications

WB

Purification

Affinity Purified

Concentration

0.5 mg/ml

Homology

Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 79%; Zebrafish: 93%

Format

Liquid. Purified antibody supplied in 1x PBS buffer.

Reconstitution

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Molecular Weight

22kDa

References & Citations

Chen, D., (2007) Oncogene 26 (35), 5029-5037

Shipping Conditions

Wet Ice

Protein Length

194

NCBI Gene Symbol

RPS7

NCBI GB Accession Number

RPS7

Host or Source

Rabbit

Protein Name

40S ribosomal protein S7

Nucleotide Accession Number

NM_001011

Peptide Sequence

RIRVKLDGSRLIKVHLDKAQQNNVEHKVETFSGVYKKLTGKDVNFEFPEF

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Streptococcus Pneumoniae tmk Protein (aa 1-212) (strain P1031)
VAng-Ly1508-50gEcoli 50 µg (E. coli)

Recombinant Streptococcus Pneumoniae tmk Protein (aa 1-212) (strain P1031)

Sign In for Pricing
View Details
DGKD, CT (Diacylglycerol Kinase delta, Diglyceride Kinase delta, DGK-delta, DAG Kinase delta, 130kD Diacylglycerol Kinase, KIAA0145) (MaxLight 550)
MBS6472412-01 0.1 mL

DGKD, CT (Diacylglycerol Kinase delta, Diglyceride Kinase delta, DGK-delta, DAG Kinase delta, 130kD Diacylglycerol Kinase, KIAA0145) (MaxLight 550)

Sign In for Pricing
View Details
DGKD, CT (Diacylglycerol Kinase delta, Diglyceride Kinase delta, DGK-delta, DAG Kinase delta, 130kD Diacylglycerol Kinase, KIAA0145) (MaxLight 550)
MBS6472412-02 5x 0.1 mL

DGKD, CT (Diacylglycerol Kinase delta, Diglyceride Kinase delta, DGK-delta, DAG Kinase delta, 130kD Diacylglycerol Kinase, KIAA0145) (MaxLight 550)

Sign In for Pricing
View Details
Lentiviral mouse Cfl1 shRNA (UAS) - Lentiviral mouseCfl1 shRNA (UAS, GFP) (25)
GTR15172148 1 Vial

Lentiviral mouse Cfl1 shRNA (UAS) - Lentiviral mouseCfl1 shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details
Rabbit anti-Schizosaccharomyces pombe (strain 972/24843)(Fission yeast) srb9 Polyclonal Antibody
MBS9008334 Inquire

Rabbit anti-Schizosaccharomyces pombe (strain 972/24843)(Fission yeast) srb9 Polyclonal Antibody

Sign In for Pricing
View Details
RPL29P17 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K1956807 1.0 µg DNA

RPL29P17 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details