Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ACTL7B Antibody - middle region : Biotin (ARP53662_P050-Biotin)

Product Specifications

Gene Name

Actin-like 7B

Gene Aliases

Tact1

Gene ID

10880

Swiss Prot

Q9Y614

Accession Number

NP_006677

Host

Rabbit

Reactivity

Human, Mouse, Rat, Cow, Dog

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human ACTL7B

Target

ACTL7B is a member of a family of actin-related proteins (ARPs) which share significant amino acid sequence identity to conventional actins. Both actins and ARPs have an actin fold, which is an ATP-binding cleft, as a common feature. The ARPs are involved in diverse cellular processes, including vesicular transport, spindle orientation, nuclear migration and chromatin remodeling. Based on mutational analysis of the ACTL7B gene in patients with this disorder, it was concluded that it is unlikely to be involved in the pathogenesis of dysautonomia. Unlike ACTL7A, the ACTL7B gene is expressed predominantly in the testis, however, its exact function is not known.The protein encoded by this gene is a member of a family of actin-related proteins (ARPs) which share significant amino acid sequence identity to conventional actins. Both actins and ARPs have an actin fold, which is an ATP-binding cleft, as a common feature. The ARPs are involved in diverse cellular processes, including vesicular transport, spindle orientation, nuclear migration and chromatin remodeling. This gene (ACTL7B), and related gene, ACTL7A, are intronless, and are located approximately 4 kb apart in a head-to-head orientation within the familial dysautonomia candidate region on 9q31. Based on mutational analysis of the ACTL7B gene in patients with this disorder, it was concluded that it is unlikely to be involved in the pathogenesis of dysautonomia. Unlike ACTL7A, the ACTL7B gene is expressed predominantly in the testis, however, its exact function is not known.

Partner Proteins

APP

Clonality

Polyclonal

Conjugation

Biotin

Type

Polyclonal Antibody

Applications

WB

Purification

Affinity Purified

Concentration

0.5 mg/ml

Homology

Cow: 77%; Dog: 83%; Human: 100%; Mouse: 85%; Rat: 92%

Format

Liquid. Purified antibody supplied in 1x PBS buffer.

Reconstitution

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Molecular Weight

46kDa

References & Citations

Humphray, S.J., (2004) Nature 429 (6990), 369-374

Shipping Conditions

Wet Ice

Protein Length

416

NCBI Gene Symbol

ACTL7B

NCBI GB Accession Number

ACTL7B

Host or Source

Rabbit

Protein Name

Actin-like protein 7B

Nucleotide Accession Number

NM_006686

Peptide Sequence

KLITIGQERFRCSEMLFQPSLAGSTQPGLPELTAACLGRCQDTGFKEEMA

More Discoveries

Explore Other Products

Browse additional items from our catalog

RSPH10B Rabbit pAb
E45R22789N-100 100 µL

RSPH10B Rabbit pAb

Sign In for Pricing
View Details
Mouse TIMM17B shRNA Plasmid
abx973118-01 150 µg

Mouse TIMM17B shRNA Plasmid

Sign In for Pricing
View Details
Mouse TIMM17B shRNA Plasmid
abx973118-02 300 µg

Mouse TIMM17B shRNA Plasmid

Sign In for Pricing
View Details
Rabbit HIF1a (Hypoxia Inducible Factor 1 Alpha) QuickTest ELISA Kit
QT-ERB0145 96 Tests

Rabbit HIF1a (Hypoxia Inducible Factor 1 Alpha) QuickTest ELISA Kit

Sign In for Pricing
View Details
TRIM45, CT (TRIM45, RNF99, Tripartite motif-containing protein 45, RING finger protein 99) (APC) discontinued
043244-APC 200 µL

TRIM45, CT (TRIM45, RNF99, Tripartite motif-containing protein 45, RING finger protein 99) (APC) discontinued

Sign In for Pricing
View Details
Myelin Basic Protein (MBP) (NM_001025092) Human Untagged Clone
SC302345 10 µg

Myelin Basic Protein (MBP) (NM_001025092) Human Untagged Clone

Sign In for Pricing
View Details