Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PADI2 Antibody - middle region : FITC (ARP52328_P050-FITC)

Product Specifications

Gene Name

Peptidyl arginine deiminase, type II

Gene Aliases

PAD2, PDI2, PAD-H19

Gene ID

11240

Swiss Prot

Q9Y2J8

Accession Number

NP_031391

Host

Rabbit

Reactivity

Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human PADI2

Target

PADI2 encodes a member of the peptidyl arginine deiminase family of enzymes, which catalyze the post-translational deimination of proteins by converting arginine residues into citrullines in the presence of calcium ions. The family members have distinct substrate specificities and tissue-specific expression patterns. The type II enzyme is the most widely expressed family member. Known substrates for this enzyme include myelin basic protein in the central nervous system and vimentin in skeletal muscle and macrophages. PADI2 is thought to play a role in the onset and progression of neurodegenerative human disorders, including Alzheimer disease and multiple sclerosis, and it has also been implicated in glaucoma pathogenesis.This gene encodes a member of the peptidyl arginine deiminase family of enzymes, which catalyze the post-translational deimination of proteins by converting arginine residues into citrullines in the presence of calcium ions. The family members have distinct substrate specificities and tissue-specific expression patterns. The type II enzyme is the most widely expressed family member. Known substrates for this enzyme include myelin basic protein in the central nervous system and vimentin in skeletal muscle and macrophages. This enzyme is thought to play a role in the onset and progression of neurodegenerative human disorders, including Alzheimer disease and multiple sclerosis, and it has also been implicated in glaucoma pathogenesis. This gene exists in a cluster with four other paralogous genes. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Partner Proteins

UBC

Clonality

Polyclonal

Conjugation

FITC: Fluorescein Isothiocyanate

Type

Polyclonal Antibody

Applications

WB

Purification

Affinity Purified

Concentration

0.5 mg/ml

Homology

Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 93%; Zebrafish: 83%

Format

Liquid. Purified antibody supplied in 1x PBS buffer.

Reconstitution

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Molecular Weight

75kDa

References & Citations

Foulquier, C., (2007) Arthritis Rheum. 56 (11), 3541-3553

Shipping Conditions

Wet Ice

Protein Length

665

NCBI Gene Symbol

PADI2

NCBI GB Accession Number

PADI2

Host or Source

Rabbit

Protein Name

Protein-arginine deiminase type-2

Nucleotide Accession Number

NM_007365

Peptide Sequence

RGDRWIQDEIEFGYIEAPHKGFPVVLDSPRDGNLKDFPVKELLGPDFGYV

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Calponin Antibody FITC
STJ500584 100 µg

Anti-Calponin Antibody FITC

Sign In for Pricing
View Details
CCDC72 (TMA7) (NM_015933) Human Recombinant Protein
TP310282M 100 µg

CCDC72 (TMA7) (NM_015933) Human Recombinant Protein

Sign In for Pricing
View Details
Mouse Monoclonal Slit2 Antibody (02) [DyLight 488]
NBP3-26894G 0.1 mL

Mouse Monoclonal Slit2 Antibody (02) [DyLight 488]

Sign In for Pricing
View Details
Quick Step Mouse Histone Deacetylase 1 (HDAC1) elisa Kit
QS0854Mo-01 48 Tests

Quick Step Mouse Histone Deacetylase 1 (HDAC1) elisa Kit

Sign In for Pricing
View Details
Quick Step Mouse Histone Deacetylase 1 (HDAC1) elisa Kit
QS0854Mo-02 96 Tests

Quick Step Mouse Histone Deacetylase 1 (HDAC1) elisa Kit

Sign In for Pricing
View Details
Microscope Slides Fish Kidney TS
4040650/13 1 Each

Microscope Slides Fish Kidney TS

Sign In for Pricing
View Details