Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HS2ST1 Antibody - middle region : FITC (ARP48741_P050-FITC)

Product Specifications

Gene Name

Heparan sulfate 2-O-sulfotransferase 1

Gene Aliases

NFSRA, dJ604K5.2

Gene ID

9653

Swiss Prot

Q7LGA3

Accession Number

NP_036394

Host

Rabbit

Reactivity

Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Zebrafish

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human HS2ST1

Target

Heparan sulfate biosynthetic enzymes are key components in generating a myriad of distinct heparan sulfate fine structures that carry out multiple biologic activities. HS2ST1 is a member of the heparan sulfate biosynthetic enzyme family that transfers sulfate to the 2 position of the iduronic acid residue of heparan sulfate. The disruption of this gene resulted in no kidney formation in knockout embryonic mice, indicating that the absence of this enzyme may interfere with the signaling required for kidney formation. Two alternatively spliced transcript variants that encode different proteins have been found for this gene.Western blots using two different antibodies against two unique regions of this protein target confirm the same apparent molecular weight in our tests.Heparan sulfate biosynthetic enzymes are key components in generating a myriad of distinct heparan sulfate fine structures that carry out multiple biologic activities. This gene encodes heparan sulfate 2-O-sulfotransferase, a member of the heparan sulfate biosynthetic enzyme family. This family member transfers sulfate to the 2 position of the iduronic acid residue of heparan sulfate. The disruption of this gene resulted in no kidney formation in knockout embryonic mice, indicating that the absence of this enzyme may interfere with the signaling required for kidney formation.

Clonality

Polyclonal

Conjugation

FITC: Fluorescein Isothiocyanate

Type

Polyclonal Antibody

Applications

WB

Purification

Affinity Purified

Sample Type

HS2ST1 is strongly supported by BioGPS gene expression data to be expressed in 721_B

Concentration

0.5 mg/ml

Homology

Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%

Format

Liquid. Purified antibody supplied in 1x PBS buffer.

Reconstitution

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Molecular Weight

42kDa

References & Citations

Xu, D., (2007) J. Biol. Chem. 282 (11), 8356-8367

Shipping Conditions

Wet Ice

Protein Length

356

NCBI Gene Symbol

HS2ST1

NCBI GB Accession Number

HS2ST1

Host or Source

Rabbit

Protein Name

Heparan sulfate 2-O-sulfotransferase 1

Nucleotide Accession Number

NM_012262

Peptide Sequence

GVTEELEDFIMLLEAALPRFFRGATELYRTGKKSHLRKTTEKKLPTKQTI

More Discoveries

Explore Other Products

Browse additional items from our catalog

Goat Anti-Feline IgG (H+L) -AP
6080-04 1.0 mL

Goat Anti-Feline IgG (H+L) -AP

Sign In for Pricing
View Details
Rabbit anti-Oryza sativa subsp. japonica (Rice) RPL27 Polyclonal Antibody
MBS7181579 Inquire

Rabbit anti-Oryza sativa subsp. japonica (Rice) RPL27 Polyclonal Antibody

Sign In for Pricing
View Details
AXIN1 (AXIN1, AXIN, Axis Inhibition Protein 1, MGC5231) (MaxLight 550)
MBS6246210-01 0.1 mL

AXIN1 (AXIN1, AXIN, Axis Inhibition Protein 1, MGC5231) (MaxLight 550)

Sign In for Pricing
View Details
AXIN1 (AXIN1, AXIN, Axis Inhibition Protein 1, MGC5231) (MaxLight 550)
MBS6246210-02 5x 0.1 mL

AXIN1 (AXIN1, AXIN, Axis Inhibition Protein 1, MGC5231) (MaxLight 550)

Sign In for Pricing
View Details
TAF1A antibody
MBS5317659-01 1 mg

TAF1A antibody

Sign In for Pricing
View Details
TAF1A antibody
MBS5317659-02 5x 1 mg

TAF1A antibody

Sign In for Pricing
View Details