Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MARCO, Mouse (HEK293, His)

MARCO Protein, a pattern recognition receptor (PRR), binds Gram-positive and Gram-negative bacteria, exhibiting a crucial role in unopsonized particle binding by alveolar macrophages.Furthermore, it interacts with the secretoglobin SCGB3A2.MARCO Protein forms disulfide-linked homotrimer structures that assemble into larger oligomers, providing an extensive surface area for interactions with substantial ligands.MARCO Protein, Mouse (HEK293, His) is the recombinant mouse-derived MARCO protein, expressed by HEK293 , with N-8*His labeled tag.

Product Specifications

Product Name Alternative

MARCO Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/marco-protein-mouse-hek-293-his.html

Purity

98.0

Smiles

QVLNLQEQLQMLEMCCGNGSLAIEDKPFFSLQWAPKTHLVPRAQGLQALQAQLSWVHTSQEQLRQQFNNLTQNPELFQIKGERGSPGPKGAPGAPGIPGLPGPAAEKGEKGAAGRDGTPGVQGPQGPPGSKGEAGLQGLTGAPGKQGATGAPGPRGEKGSKGDIGLTGPKGEHGTKGDKGDLGLPGNKGDMGMKGDTGPMGSPGAQGGKGDAGKPGLPGLAGSPGVKGDQGKPGVQGVPGPQGAPGLSGAKGEPGRTGLPGPAGPPGIAGNPGIAGVKGSKGDTGIQGQKGTKGESGVPGLVGRKGDTGSPGLAGPKGEPGRVGQKGDPGMKGSSGQQGQKGEKGQKGESFQRVRIMGGTNRGRAEVYYNNEWGTICDDDWDNNDATVFCRMLGYSRGRALSSYGGGSGNIWLDNVNCRGTENSLWDCSKNSWGNHNCVHNEDAGVECS

Molecular Formula

17167 (Gene_ID) Q60754 (Q70-S518) (Accession)

Molecular Weight

55-65 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ATP6V0D2 (NM_152565) Human Recombinant Protein
TP309007M 100 µg

ATP6V0D2 (NM_152565) Human Recombinant Protein

Sign In for Pricing
View Details
Traesolide
TRC-T704500-25MG 25 mg

Traesolide

Sign In for Pricing
View Details
MTRNR2L5 Human Gene Knockout Kit (CRISPR)
KN430905 1 Kit

MTRNR2L5 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Semaphorin 3B (SEMA3B) (NM_001005914) Human Over-expression Lysate
LY423670 100 µg

Semaphorin 3B (SEMA3B) (NM_001005914) Human Over-expression Lysate

Sign In for Pricing
View Details
DBF4B Human Gene Knockout Kit (CRISPR)
KN414891 1 Kit

DBF4B Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
HSZFP36 (ZNF823) (NM_001080493) Human Recombinant Protein
TP761956 50 µg

HSZFP36 (ZNF823) (NM_001080493) Human Recombinant Protein

Sign In for Pricing
View Details