Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MARCO, Mouse (HEK293, His)

MARCO Protein, a pattern recognition receptor (PRR), binds Gram-positive and Gram-negative bacteria, exhibiting a crucial role in unopsonized particle binding by alveolar macrophages.Furthermore, it interacts with the secretoglobin SCGB3A2.MARCO Protein forms disulfide-linked homotrimer structures that assemble into larger oligomers, providing an extensive surface area for interactions with substantial ligands.MARCO Protein, Mouse (HEK293, His) is the recombinant mouse-derived MARCO protein, expressed by HEK293 , with N-8*His labeled tag.

Product Specifications

Product Name Alternative

MARCO Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/marco-protein-mouse-hek-293-his.html

Purity

98.0

Smiles

QVLNLQEQLQMLEMCCGNGSLAIEDKPFFSLQWAPKTHLVPRAQGLQALQAQLSWVHTSQEQLRQQFNNLTQNPELFQIKGERGSPGPKGAPGAPGIPGLPGPAAEKGEKGAAGRDGTPGVQGPQGPPGSKGEAGLQGLTGAPGKQGATGAPGPRGEKGSKGDIGLTGPKGEHGTKGDKGDLGLPGNKGDMGMKGDTGPMGSPGAQGGKGDAGKPGLPGLAGSPGVKGDQGKPGVQGVPGPQGAPGLSGAKGEPGRTGLPGPAGPPGIAGNPGIAGVKGSKGDTGIQGQKGTKGESGVPGLVGRKGDTGSPGLAGPKGEPGRVGQKGDPGMKGSSGQQGQKGEKGQKGESFQRVRIMGGTNRGRAEVYYNNEWGTICDDDWDNNDATVFCRMLGYSRGRALSSYGGGSGNIWLDNVNCRGTENSLWDCSKNSWGNHNCVHNEDAGVECS

Molecular Formula

17167 (Gene_ID) Q60754 (Q70-S518) (Accession)

Molecular Weight

55-65 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human JHY activation kit by CRISPRa
GA112686 1 Kit

Human JHY activation kit by CRISPRa

Sign In for Pricing
View Details
Human Sequestosome 1 (SQSTM1) ELISA Kit
RDR-SQSTM1-Hu-01 96 Tests

Human Sequestosome 1 (SQSTM1) ELISA Kit

Sign In for Pricing
View Details
Human Sequestosome 1 (SQSTM1) ELISA Kit
RDR-SQSTM1-Hu-02 48 Tests

Human Sequestosome 1 (SQSTM1) ELISA Kit

Sign In for Pricing
View Details
BHMT Mouse Monoclonal Antibody [9E1]
EM1701-64 100 µL

BHMT Mouse Monoclonal Antibody [9E1]

Sign In for Pricing
View Details
Frozen Tissue Blocks, Breast
CB525234 1 Block

Frozen Tissue Blocks, Breast

Sign In for Pricing
View Details
Elab Fluor® 700 Anti-Mouse CD106 Antibody[M/K-2.7]
E-AB-F1091UM1-01 25 µg

Elab Fluor® 700 Anti-Mouse CD106 Antibody[M/K-2.7]

Sign In for Pricing
View Details