Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MARCO, Mouse (HEK293, His)

MARCO Protein, a pattern recognition receptor (PRR), binds Gram-positive and Gram-negative bacteria, exhibiting a crucial role in unopsonized particle binding by alveolar macrophages.Furthermore, it interacts with the secretoglobin SCGB3A2.MARCO Protein forms disulfide-linked homotrimer structures that assemble into larger oligomers, providing an extensive surface area for interactions with substantial ligands.MARCO Protein, Mouse (HEK293, His) is the recombinant mouse-derived MARCO protein, expressed by HEK293 , with N-8*His labeled tag.

Product Specifications

Product Name Alternative

MARCO Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/marco-protein-mouse-hek-293-his.html

Purity

98.0

Smiles

QVLNLQEQLQMLEMCCGNGSLAIEDKPFFSLQWAPKTHLVPRAQGLQALQAQLSWVHTSQEQLRQQFNNLTQNPELFQIKGERGSPGPKGAPGAPGIPGLPGPAAEKGEKGAAGRDGTPGVQGPQGPPGSKGEAGLQGLTGAPGKQGATGAPGPRGEKGSKGDIGLTGPKGEHGTKGDKGDLGLPGNKGDMGMKGDTGPMGSPGAQGGKGDAGKPGLPGLAGSPGVKGDQGKPGVQGVPGPQGAPGLSGAKGEPGRTGLPGPAGPPGIAGNPGIAGVKGSKGDTGIQGQKGTKGESGVPGLVGRKGDTGSPGLAGPKGEPGRVGQKGDPGMKGSSGQQGQKGEKGQKGESFQRVRIMGGTNRGRAEVYYNNEWGTICDDDWDNNDATVFCRMLGYSRGRALSSYGGGSGNIWLDNVNCRGTENSLWDCSKNSWGNHNCVHNEDAGVECS

Molecular Formula

17167 (Gene_ID) Q60754 (Q70-S518) (Accession)

Molecular Weight

55-65 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NDOR1 (NM_001144028) Human Over-expression Lysate
LC428475 20 µg

NDOR1 (NM_001144028) Human Over-expression Lysate

Sign In for Pricing
View Details
Frozen Tissue Sections, Artery: peripheral
CS630286 5x 5 µm

Frozen Tissue Sections, Artery: peripheral

Sign In for Pricing
View Details
Cfap52 Mouse Gene Knockout Kit (CRISPR)
KN519339 1 Kit

Cfap52 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
RAF1 pSer259 Rabbit Polyclonal Antibody
AP20904PU-N 100 µg

RAF1 pSer259 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Cckbr Mouse Gene Knockout Kit (CRISPR)
KN502776 1 Kit

Cckbr Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Dodecane
TRC-D494625-150ML 150 mL

Dodecane

Sign In for Pricing
View Details