Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

WNT6 Antibody - middle region : FITC (ARP46733_P050-FITC)

Product Specifications

Gene Name

Wingless-type MMTV integration site family, member 6

Gene ID

7475

Swiss Prot

Q9Y6F9

Accession Number

NP_006513

Host

Rabbit

Reactivity

Human, Mouse, Rat, Cow, Dog, Guinea Pig, Rabbit

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human WNT6

Target

The WNT family consists of several secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis. WNT6 is overexpressed in cervical cancer cell line and strongly coexpressed with another family member, WNT10A, in colorectal cancer cell line. The WNT6 protein overexpression may play key roles in carcinogenesis. The WNT gene family consists of structurally related genes which encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis. This gene is a member of the WNT gene family. It is overexpressed in cervical cancer cell line and strongly coexpressed with another family member, WNT10A, in colorectal cancer cell line. The gene overexpression may play key roles in carcinogenesis. This gene and the WNT10A gene are clustered in the chromosome 2q35 region. The protein encoded by this gene is 97% identical to the mouse Wnt6 protein at the amino acid level.

Partner Proteins

PORCN

Clonality

Polyclonal

Conjugation

FITC: Fluorescein Isothiocyanate

Type

Polyclonal Antibody

Applications

WB

Purification

Affinity Purified

Sample Type

WNT6 is supported by BioGPS gene expression data to be expressed in HEK293T

Concentration

0.5 mg/ml

Homology

Cow: 100%; Dog: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%

Format

Liquid. Purified antibody supplied in 1x PBS buffer.

Reconstitution

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Molecular Weight

37kDa

References & Citations

Adaimy, L., (2007) Am. J. Hum. Genet. 81 (4), 821-828

Shipping Conditions

Wet Ice

Protein Length

365

NCBI Gene Symbol

WNT6

NCBI GB Accession Number

WNT6

Host or Source

Rabbit

Protein Name

Protein Wnt-6

Nucleotide Accession Number

NM_006522

Peptide Sequence

ERFHGASRVMGTNDGKALLPAVRTLKPPGRADLLYAADSPDFCAPNRRTG

More Discoveries

Explore Other Products

Browse additional items from our catalog

EIF4E antibody
FNab10356 100 µg

EIF4E antibody

Sign In for Pricing
View Details
Lentiviral human KCNQ5 sgRNA gene knockout kit - Lentiviral human KCNQ5 sgRNA gene knockout kit (100)
GTR15372967 1 Vial

Lentiviral human KCNQ5 sgRNA gene knockout kit - Lentiviral human KCNQ5 sgRNA gene knockout kit (100)

Sign In for Pricing
View Details
Lentiviral human PHETA1 shRNA (UAS) - Lentiviral human PHETA1 shRNA (UAS, iRFP) (100)
GTR15336942 1 Vial

Lentiviral human PHETA1 shRNA (UAS) - Lentiviral human PHETA1 shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
Kinesis EVOL Plunger; 50ul
CHR2135 1 Each

Kinesis EVOL Plunger; 50ul

Sign In for Pricing
View Details
N, N-Diethyl 3-bromo-5-methylbenzenesulfonamide
459789-01 100 mg

N, N-Diethyl 3-bromo-5-methylbenzenesulfonamide

Sign In for Pricing
View Details
N, N-Diethyl 3-bromo-5-methylbenzenesulfonamide
459789-02 250 mg

N, N-Diethyl 3-bromo-5-methylbenzenesulfonamide

Sign In for Pricing
View Details