Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CDS1 Antibody - middle region : Biotin (ARP45073_P050-Biotin)

Product Specifications

Gene Name

CDP-diacylglycerol synthase (phosphatidate cytidylyltransferase) 1

Gene Aliases

CDS 1

Gene ID

1040

Swiss Prot

Q92903

Accession Number

NP_001254

Host

Rabbit

Reactivity

Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human CDS1

Target

Breakdown products of phosphoinositides are ubiquitous second messengers that function downstream of many G protein-coupled receptors and tyrosine kinases regulating cell growth, calcium metabolism, and protein kinase C activity. CDS1 is an enzyme which regulates the amount of phosphatidylinositol available for signaling by catalyzing the conversion of phosphatidic acid to CDP-diacylglycerol. This enzyme is an integral membrane protein localized to two subcellular domains, the matrix side of the inner mitochondrial membrane where it is thought to be involved in the synthesis of phosphatidylglycerol and cardiolipin and the cytoplasmic side of the endoplasmic reticulum where it functions in phosphatidylinositol biosynthesis.Breakdown products of phosphoinositides are ubiquitous second messengers that function downstream of many G protein-coupled receptors and tyrosine kinases regulating cell growth, calcium metabolism, and protein kinase C activity. This gene encodes an enzyme which regulates the amount of phosphatidylinositol available for signaling by catalyzing the conversion of phosphatidic acid to CDP-diacylglycerol. This enzyme is an integral membrane protein localized to two subcellular domains, the matrix side of the inner mitochondrial membrane where it is thought to be involved in the synthesis of phosphatidylglycerol and cardiolipin and the cytoplasmic side of the endoplasmic reticulum where it functions in phosphatidylinositol biosynthesis. Two genes encoding this enzyme have been identified in humans, one mapping to human chromosome 4q21 and a second to 20p13.

Partner Proteins

UBC; CDC25C

Clonality

Polyclonal

Conjugation

Biotin

Type

Polyclonal Antibody

Applications

WB

Purification

Affinity Purified

Sample Type

CDS1 is supported by BioGPS gene expression data to be expressed in HEK293T

Concentration

0.5 mg/ml

Homology

Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%

Format

Liquid. Purified antibody supplied in 1x PBS buffer.

Reconstitution

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Molecular Weight

53kDa

References & Citations

Volta, M., (1999) Genomics 55 (1), 68-77

Shipping Conditions

Wet Ice

Protein Length

461

NCBI Gene Symbol

CDS1

NCBI GB Accession Number

CDS1

Host or Source

Rabbit

Protein Name

Phosphatidate cytidylyltransferase 1

Nucleotide Accession Number

NM_001263

Peptide Sequence

VVFGFIAAYVLSKYQYFVCPVEYRSDVNSFVTECEPSELFQLQTYSLPPF

More Discoveries

Explore Other Products

Browse additional items from our catalog

SET, NT (SET, Protein SET, HLA-DR-associated protein II, Inhibitor of granzyme A-activated DNase, PHAPII, Phosphatase 2A inhibitor I2PP2A, Template-activating factor I) (MaxLight 550)
MBS6346445-01 0.1 mL

SET, NT (SET, Protein SET, HLA-DR-associated protein II, Inhibitor of granzyme A-activated DNase, PHAPII, Phosphatase 2A inhibitor I2PP2A, Template-activating factor I) (MaxLight 550)

Sign In for Pricing
View Details
SET, NT (SET, Protein SET, HLA-DR-associated protein II, Inhibitor of granzyme A-activated DNase, PHAPII, Phosphatase 2A inhibitor I2PP2A, Template-activating factor I) (MaxLight 550)
MBS6346445-02 5x 0.1 mL

SET, NT (SET, Protein SET, HLA-DR-associated protein II, Inhibitor of granzyme A-activated DNase, PHAPII, Phosphatase 2A inhibitor I2PP2A, Template-activating factor I) (MaxLight 550)

Sign In for Pricing
View Details
B3GALT5 (NM_033171) Human Recombinant Protein
TP314721L 1 mg

B3GALT5 (NM_033171) Human Recombinant Protein

Sign In for Pricing
View Details
GOLGA3 Antibody
MBS5311766-01 0.1 mL

GOLGA3 Antibody

Sign In for Pricing
View Details
GOLGA3 Antibody
MBS5311766-02 5x 0.1 mL

GOLGA3 Antibody

Sign In for Pricing
View Details
Rabbit Polyclonal ZFAND2B Antibody [Allophycocyanin]
NBP2-97819APC 0.1 mL

Rabbit Polyclonal ZFAND2B Antibody [Allophycocyanin]

Sign In for Pricing
View Details