Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CXCL16, Mouse

CXCL16, also known as SR-PSOX (scavenger receptor that binds phosphatidylserine and oxidized lipoprotein), is one member of the ELR-negative CXC chemokine subfamily. CXCL16 is a multifunctional protein involved in various inflammatory diseases, atherosclerosis, and cancer. CXCL16 can be observed in many cell types[1][2]. CXCL16 Protein, Mouse is produced in E. coli, and consists of 88 amino acids (N27-P114) .

Product Specifications

Product Name Alternative

CXCL16 Protein, Mouse, Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cxcl16-protein-mouse.html

Purity

98.0

Smiles

NQGSVAGSCSCDRTISSGTQIPQGTLDHIRKYLKAFHRCPFFIRFQLQSKSVCGGSQDQWVRELVDCFERKECGTGHGKSFHHQKHLP

Molecular Formula

66102 (Gene_ID) Q8BSU2 (N27-P114) (Accession)

Molecular Weight

Approximately 9.9 kDa

References & Citations

[1]Allaoui R, et al. Cancer-associated fibroblast-secreted CXCL16 attracts monocytes to promote stroma activation in triple-negative breast cancers. Nat Commun. 2016 Oct 11;7:13050.|[2]Tohyama M, et al. CXCL16 is a novel mediator of the innate immunity of epidermal keratinocytes. Int Immunol. 2007 Sep;19 (9) :1095-102.|[3]Tohyama M, et al. CXCL16 is a novel mediator of the innate immunity of epidermal keratinocytes. Int Immunol. 2007 Sep;19 (9) :1095-102.|[4]Jianhui Sun, et al. A Functional Variant of CXCL16 Is Associated With Predisposition to Sepsis and MODS in Trauma Patients: Genetic Association Studies. Front Genet. 2021 Sep 3;12:720313.|[5]Allaoui R, et al. Cancer-associated fibroblast-secreted CXCL16 attracts monocytes to promote stroma activation in triple-negative breast cancers. Nat Commun. 2016 Oct 11;7:13050.|[6]Sheng Zuo, et al. CXCL16 Induces the Progression of Pulmonary Fibrosis through Promoting the Phosphorylation of STAT3. Can Respir J. 2019 Jul 10;2019:2697376.|[7]Yi Gong, et al. Prognostic and pathogenic role of CXC motif ligand 16 in sepsis. Microbes Infect. 2022 Feb;24 (1) :104882.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MLCK/MYLK (Myosin Light Chain Kinase) Rabbit ELISA Kit
F0574 96 Tests

MLCK/MYLK (Myosin Light Chain Kinase) Rabbit ELISA Kit

Sign In for Pricing
View Details
N-Boc-glycine
FB18945-01 2 Kg

N-Boc-glycine

Sign In for Pricing
View Details
N-Boc-glycine
FB18945-02 5 Kg

N-Boc-glycine

Sign In for Pricing
View Details
OAT Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV712985 1.0 µg DNA

OAT Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details
Guinea Pig Collagen Alpha 1 (XXVII) chain (COL27A1) ELISA kit
GTR10461192 96 Well

Guinea Pig Collagen Alpha 1 (XXVII) chain (COL27A1) ELISA kit

Sign In for Pricing
View Details
Monoclonal Antibody to Complement Component 1, Q Subcomponent Like Protein 1 (C1qL1)
TRV-0059788-01 20 µL

Monoclonal Antibody to Complement Component 1, Q Subcomponent Like Protein 1 (C1qL1)

Sign In for Pricing
View Details