Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ABCD4 Antibody - N-terminal region : FITC (ARP43655_P050-FITC)

Product Specifications

Gene Name

ATP-binding cassette, sub-family D (ALD), member 4

Gene Aliases

P70R, P79R, ABC41, MAHCJ, PMP69, PXMP1L, EST352188

Gene ID

5826

Swiss Prot

O14678

Accession Number

NP_005041

Host

Rabbit

Reactivity

Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ABCD4

Target

ABCD4 is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White) . This protein is a member of the ALD subfamily, which is involved in peroxisomal import of fatty acids and/or fatty acyl-CoAs in the organelle. All known peroxisomal ABC transporters are half transporters which require a partner half transporter molecule to form a functional homodimeric or heterodimeric transporter. The function of this peroxisomal membrane protein is unknown. However, it is speculated that it may function as a heterodimer for another peroxisomal ABC transporter and, therefore, may modify the adrenoleukodystrophy phenotype. It may also play a role in the process of peroxisome biogenesis. The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White) . This protein is a member of the ALD subfamily, which is involved in peroxisomal import of fatty acids and/or fatty acyl-CoAs in the organelle. All known peroxisomal ABC transporters are half transporters which require a partner half transporter molecule to form a functional homodimeric or heterodimeric transporter. The function of this peroxisomal membrane protein is unknown. However, it is speculated that it may function as a heterodimer for another peroxisomal ABC transporter and, therefore, may modify the adrenoleukodystrophy phenotype. It may also play a role in the process of peroxisome biogenesis. Alternative splicing results in at least two different transcript variants, one which is protein-coding and one which is probably not protein-coding.

Partner Proteins

UBC; SARAF; PEA15; XRCC6; DLEU1

Clonality

Polyclonal

Conjugation

FITC: Fluorescein Isothiocyanate

Type

Polyclonal Antibody

Applications

WB

Purification

Affinity Purified

Sample Type

ABCD4 is strongly supported by BioGPS gene expression data to be expressed in 721_B

Concentration

0.5 mg/ml

Homology

Cow: 93%; Dog: 93%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%

Format

Liquid. Purified antibody supplied in 1x PBS buffer.

Reconstitution

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Molecular Weight

68kDa

References & Citations

Asheuer, M., (2005) Hum. Mol. Genet. 14 (10), 1293-1303

Shipping Conditions

Wet Ice

Protein Length

606

NCBI Gene Symbol

ABCD4

NCBI GB Accession Number

ABCD4

Host or Source

Rabbit

Protein Name

ATP-binding cassette sub-family D member 4

Nucleotide Accession Number

NM_005050

Peptide Sequence

YVSWRKDLTEHLHRLYFRGRAYYTLNVLRDDIDNPDQRISQDVERFCRQL

More Discoveries

Explore Other Products

Browse additional items from our catalog

RN-tre Polyclonal Antibody
UB-GEN-2711 100 µL

RN-tre Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Nitrosomonas eutropha Probable tRNA threonylcarbamoyladenosine bios
MBS7071978-01 0.05 mg (E-Coli)

Recombinant Nitrosomonas eutropha Probable tRNA threonylcarbamoyladenosine bios

Sign In for Pricing
View Details
Recombinant Nitrosomonas eutropha Probable tRNA threonylcarbamoyladenosine bios
MBS7071978-02 0.05 mg (Yeast)

Recombinant Nitrosomonas eutropha Probable tRNA threonylcarbamoyladenosine bios

Sign In for Pricing
View Details
Recombinant Nitrosomonas eutropha Probable tRNA threonylcarbamoyladenosine bios
MBS7071978-03 0.2 mg (E-Coli)

Recombinant Nitrosomonas eutropha Probable tRNA threonylcarbamoyladenosine bios

Sign In for Pricing
View Details
Recombinant Nitrosomonas eutropha Probable tRNA threonylcarbamoyladenosine bios
MBS7071978-04 0.05 mg (Baculovirus)

Recombinant Nitrosomonas eutropha Probable tRNA threonylcarbamoyladenosine bios

Sign In for Pricing
View Details
Recombinant Nitrosomonas eutropha Probable tRNA threonylcarbamoyladenosine bios
MBS7071978-05 0.5 mg (E-Coli)

Recombinant Nitrosomonas eutropha Probable tRNA threonylcarbamoyladenosine bios

Sign In for Pricing
View Details