Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ABCD4 Antibody - N-terminal region : Biotin (ARP43655_P050-Biotin)

Product Specifications

Gene Name

ATP-binding cassette, sub-family D (ALD), member 4

Gene Aliases

P70R, P79R, ABC41, MAHCJ, PMP69, PXMP1L, EST352188

Gene ID

5826

Swiss Prot

O14678

Accession Number

NP_005041

Host

Rabbit

Reactivity

Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ABCD4

Target

ABCD4 is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White) . This protein is a member of the ALD subfamily, which is involved in peroxisomal import of fatty acids and/or fatty acyl-CoAs in the organelle. All known peroxisomal ABC transporters are half transporters which require a partner half transporter molecule to form a functional homodimeric or heterodimeric transporter. The function of this peroxisomal membrane protein is unknown. However, it is speculated that it may function as a heterodimer for another peroxisomal ABC transporter and, therefore, may modify the adrenoleukodystrophy phenotype. It may also play a role in the process of peroxisome biogenesis. The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White) . This protein is a member of the ALD subfamily, which is involved in peroxisomal import of fatty acids and/or fatty acyl-CoAs in the organelle. All known peroxisomal ABC transporters are half transporters which require a partner half transporter molecule to form a functional homodimeric or heterodimeric transporter. The function of this peroxisomal membrane protein is unknown. However, it is speculated that it may function as a heterodimer for another peroxisomal ABC transporter and, therefore, may modify the adrenoleukodystrophy phenotype. It may also play a role in the process of peroxisome biogenesis. Alternative splicing results in at least two different transcript variants, one which is protein-coding and one which is probably not protein-coding.

Partner Proteins

UBC; SARAF; PEA15; XRCC6; DLEU1

Clonality

Polyclonal

Conjugation

Biotin

Type

Polyclonal Antibody

Applications

WB

Purification

Affinity Purified

Sample Type

ABCD4 is strongly supported by BioGPS gene expression data to be expressed in 721_B

Concentration

0.5 mg/ml

Homology

Cow: 93%; Dog: 93%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%

Format

Liquid. Purified antibody supplied in 1x PBS buffer.

Reconstitution

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Molecular Weight

68kDa

References & Citations

Asheuer, M., (2005) Hum. Mol. Genet. 14 (10), 1293-1303

Shipping Conditions

Wet Ice

Protein Length

606

NCBI Gene Symbol

ABCD4

NCBI GB Accession Number

ABCD4

Host or Source

Rabbit

Protein Name

ATP-binding cassette sub-family D member 4

Nucleotide Accession Number

NM_005050

Peptide Sequence

YVSWRKDLTEHLHRLYFRGRAYYTLNVLRDDIDNPDQRISQDVERFCRQL

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti Itopride Pab
165626 100 µg

Anti Itopride Pab

Sign In for Pricing
View Details
ZNFX1 Protein Vector (Mouse) (pPM-C-His)
PV250965 500 ng

ZNFX1 Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
CASPASE-3 (CPP32, CASP-3, CPP-32, PARP Cleavage Protease, SREBP Cleavage Activity 1, Protein Yama (Protein of Death) ) discontinued
396984 100 µL

CASPASE-3 (CPP32, CASP-3, CPP-32, PARP Cleavage Protease, SREBP Cleavage Activity 1, Protein Yama (Protein of Death) ) discontinued

Sign In for Pricing
View Details
Trpv1 Mouse Monoclonal Antibody [Clone ID: N221/17]
75-254 100 µL

Trpv1 Mouse Monoclonal Antibody [Clone ID: N221/17]

Sign In for Pricing
View Details
Iba57 Rat shRNA Plasmid (Locus ID 363611)
TR707356 1 Kit

Iba57 Rat shRNA Plasmid (Locus ID 363611)

Sign In for Pricing
View Details
CDK5 (Cyclin-dependent Kinase 5, Cell Division Protein Kinase 5, Cyclin-dependent Kinase 5, Serine/Threonine-protein Kinase PSSALRE, Tau Protein Kinase II Catalytic Subunit, TPKII Catalytic Subunit)
C2575-06B 100 µg

CDK5 (Cyclin-dependent Kinase 5, Cell Division Protein Kinase 5, Cyclin-dependent Kinase 5, Serine/Threonine-protein Kinase PSSALRE, Tau Protein Kinase II Catalytic Subunit, TPKII Catalytic Subunit)

Sign In for Pricing
View Details