Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ABCC3 Antibody - middle region : HRP (ARP43645_P050-HRP)

Product Specifications

Gene Name

ATP-binding cassette, sub-family C (CFTR/MRP), member 3

Gene Aliases

MLP2, MRP3, ABC31, MOAT-D, cMOAT2, EST90757

Gene ID

8714

Swiss Prot

O15438

Accession Number

NP_003777

Host

Rabbit

Reactivity

Human, Rat, Dog, Guinea Pig, Horse, Pig

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human ABCC3

Target

ABCC3 is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White) . This protein is a member of the MRP subfamily which is involved in multi-drug resistance. The specific function of this protein has not yet been determined; however, this protein may play a role in the transport of biliary and intestinal excretion of organic anions. Alternatively spliced variants which encode different protein isoforms have been described; however, not all variants have been fully characterized. The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White) . This protein is a member of the MRP subfamily which is involved in multi-drug resistance. The specific function of this protein has not yet been determined; however, this protein may play a role in the transport of biliary and intestinal excretion of organic anions. Alternatively spliced variants which encode different protein isoforms have been described; however, not all variants have been fully characterized. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Partner Proteins

UBC; MLH1

Clonality

Polyclonal

Conjugation

HRP: Horseradish Peroxidase

Type

Polyclonal Antibody

Applications

WB

Purification

Affinity Purified

Concentration

0.5 mg/ml

Homology

Dog: 77%; Guinea Pig: 79%; Horse: 79%; Human: 100%; Pig: 86%; Rat: 79%

Format

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Reconstitution

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Molecular Weight

168kDa

References & Citations

Muller, P., (2008) Leuk. Res. 32 (6), 919-929

Shipping Conditions

Wet Ice

Protein Length

1527

NCBI Gene Symbol

ABCC3

NCBI GB Accession Number

ABCC3

Host or Source

Rabbit

Protein Name

Canalicular multispecific organic anion transporter 2

Nucleotide Accession Number

NM_003786

Peptide Sequence

KVHMKGSVAYVPQQAWIQNCTLQENVLFGKALNPKRYQQTLEACALLADL

More Discoveries

Explore Other Products

Browse additional items from our catalog

ACOT11 (Acyl-coenzyme A Thioesterase 11, Acyl-CoA Thioesterase 11, Acyl-CoA Thioester Hydrolase 11, Adipose-associated Thioesterase, Brown Fat-inducible Thioesterase, BFIT, KIAA0707, THEA, THEM1, STARD14) (MaxLight 550)
134412-ML550 100 µL

ACOT11 (Acyl-coenzyme A Thioesterase 11, Acyl-CoA Thioesterase 11, Acyl-CoA Thioester Hydrolase 11, Adipose-associated Thioesterase, Brown Fat-inducible Thioesterase, BFIT, KIAA0707, THEA, THEM1, STARD14) (MaxLight 550)

Sign In for Pricing
View Details
RNF182 AAV Vector (Rat) (CMV)
40274106 1 µg

RNF182 AAV Vector (Rat) (CMV)

Sign In for Pricing
View Details
Fam70b 3'UTR GFP Stable Cell Line
TU156304 1.0 mL

Fam70b 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Human Kelch repeat and BTB domain-containing protein 12 (KBTBD12) ELISA Kit
abx529435 96 Tests

Human Kelch repeat and BTB domain-containing protein 12 (KBTBD12) ELISA Kit

Sign In for Pricing
View Details
APC_Cy7-Linked Monoclonal Antibody to Casein Kappa (CSN3)
MBS2163413-01 0.1 mL

APC_Cy7-Linked Monoclonal Antibody to Casein Kappa (CSN3)

Sign In for Pricing
View Details
APC_Cy7-Linked Monoclonal Antibody to Casein Kappa (CSN3)
MBS2163413-02 0.2 mL

APC_Cy7-Linked Monoclonal Antibody to Casein Kappa (CSN3)

Sign In for Pricing
View Details