Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

STC1 Antibody - N-terminal region : Biotin (ARP42104_P050-Biotin)

Product Specifications

Gene Name

Stanniocalcin 1

Gene Aliases

STC

Gene ID

6781

Swiss Prot

P52823

Accession Number

NP_003146

Host

Rabbit

Reactivity

Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human STC1

Target

STC1 is a secreted, homodimeric glycoprotein that is expressed in a wide variety of tissues and may have autocrine or paracrine functions. It contains 11 conserved cysteine residues and is phosphorylated by protein kinase C exclusively on its serine residues. The protein may play a role in the regulation of renal and intestinal calcium and phosphate transport, cell metabolism, or cellular calcium/phosphate homeostasis. Overexpression of human stanniocalcin 1 in mice produces high serum phosphate levels, dwarfism, and increased metabolic rate.This gene encodes a secreted, homodimeric glycoprotein that is expressed in a wide variety of tissues and may have autocrine or paracrine functions. The gene contains a 5' UTR rich in CAG trinucleotide repeats. The encoded protein contains 11 conserved cysteine residues and is phosphorylated by protein kinase C exclusively on its serine residues. The protein may play a role in the regulation of renal and intestinal calcium and phosphate transport, cell metabolism, or cellular calcium/phosphate homeostasis. Overexpression of human stanniocalcin 1 in mice produces high serum phosphate levels, dwarfism, and increased metabolic rate. This gene has altered expression in hepatocellular, ovarian, and breast cancers. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Clonality

Polyclonal

Conjugation

Biotin

Type

Polyclonal Antibody

Applications

WB

Purification

Affinity Purified

Sample Type

There is BioGPS gene expression data showing that STC1 is expressed in 721_B

Concentration

0.5 mg/ml

Homology

Cow: 93%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 93%; Rat: 100%

Format

Liquid. Purified antibody supplied in 1x PBS buffer.

Reconstitution

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Molecular Weight

26kDa

References & Citations

Chen, C., (2008) Arterioscler. Thromb. Vasc. Biol. 28 (5), 906-912

Shipping Conditions

Wet Ice

Protein Length

247

NCBI Gene Symbol

STC1

NCBI GB Accession Number

STC1

Host or Source

Rabbit

Protein Name

Stanniocalcin-1

Nucleotide Accession Number

NM_003155

Peptide Sequence

MLQNSAVLLVLVISASATHEAEQNDSVSPRKSRVAAQNSAEVVRCLNSAL

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal CD63 Antibody (LAMP3/968) [mFluor Violet 610 SE]
NBP2-47936MFV610 0.1 mL

Mouse Monoclonal CD63 Antibody (LAMP3/968) [mFluor Violet 610 SE]

Sign In for Pricing
View Details
Rabbit Polyclonal FAM83C Antibody [Janelia Fluor 549]
NBP2-98186JF549 0.1 mL

Rabbit Polyclonal FAM83C Antibody [Janelia Fluor 549]

Sign In for Pricing
View Details
PHOS Recombinant Rabbit mAb
BS48365-01 50 µL

PHOS Recombinant Rabbit mAb

Sign In for Pricing
View Details
PHOS Recombinant Rabbit mAb
BS48365-02 100 µL

PHOS Recombinant Rabbit mAb

Sign In for Pricing
View Details
Mouse Or5an1 qPCR Primer Pair
QM66666S 200 Tests

Mouse Or5an1 qPCR Primer Pair

Sign In for Pricing
View Details
Matriptase, NT (ST14, Suppressor Of Tumorigenicity 14 Protein, Membrane-type Serine Protease 1, Serine Protease 14, Serine Protease TADG-15, Tumor-associated Differentially-expressed Gene 15 Protein, SNC19, Epitin, Prostamin, TADG15, MT-SP1, MTSP1, PRSS14)
M2419-25G 50 µg

Matriptase, NT (ST14, Suppressor Of Tumorigenicity 14 Protein, Membrane-type Serine Protease 1, Serine Protease 14, Serine Protease TADG-15, Tumor-associated Differentially-expressed Gene 15 Protein, SNC19, Epitin, Prostamin, TADG15, MT-SP1, MTSP1, PRSS14)

Sign In for Pricing
View Details