Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GRO-alpha/CXCL1, Rat

CXCL1 (Chemokine (C-X-C motif) ligand 1), also known as GRO alpha, NAP-3 or MGSA, belongs to the sub-family of CXC chemokine. CXCL1 is involved in the development of many inflammatory diseases, including the induction of angiogenesis and recruitment of neutrophils. CXCL1 is produced by many cell types, and activates CXCR2 and, at high levels, CXCR1[1]. GRO-alpha/CXCL1 Protein, Rat is produced in E. coli, and consists of 72 amino acids (A25-N96) .

Product Specifications

Product Name Alternative

GRO-alpha/CXCL1 Protein, Rat, Rat, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gro-alpha-cxcl1-protein-rat.html

Purity

97.0

Smiles

APVANELRCQCLQTVAGIHFKNIQSLKVMPPGPHCTQTEVIATLKNGREACLDPEAPMVQKIVQKMLKGVPK

Molecular Formula

81503 (Gene_ID) P14095 (A25-K96) (Accession)

Molecular Weight

Approximately 10 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Dhawan P, et al. Role of CXCL1 in tumorigenesis of melanoma. J Leukoc Biol. 2002 Jul;72 (1) :9-18.|[2]Jan Korbecki, et al. CXCL1: Gene, Promoter, Regulation of Expression, mRNA Stability, Regulation of Activity in the Intercellular Space. Int J Mol Sci. 2022 Jan 12;23 (2) :792.|[3]Sheng-Mou Hou, et al. CXCL1 contributes to IL-6 expression in osteoarthritis and rheumatoid arthritis synovial fibroblasts by CXCR2, c-Raf, MAPK, and AP-1 pathway. Arthritis Res Ther. 2020 Oct 21;22 (1) :251.|[4]Huey-ming Lo, et al. TNF-α induces CXCL1 chemokine expression and release in human vascular endothelial cells in vitro via two distinct signaling pathways. Acta Pharmacol Sin. 2014 Mar;35 (3) :339-50.|[5]Pascale Ribaux, et al. Induction of CXCL1 by extracellular matrix and autocrine enhancement by interleukin-1 in rat pancreatic beta-cells. Endocrinology. 2007 Nov;148 (11) :5582-90.|[6]Thamyris Reis Moraes, et al. Participation of CXCL1 in the glial cells during neuropathic pain. Eur J Pharmacol. 2020 May 15;875:173039.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PAX5 Human Gene Knockout Kit (CRISPR)
KN422785 1 Kit

PAX5 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Pure Arum maculatum Lectin (Lords and Ladies) -AMA-
L-8012-1 1 mg

Pure Arum maculatum Lectin (Lords and Ladies) -AMA-

Sign In for Pricing
View Details
Glutathione S Transferase kappa 1 (GSTK1) (NM_001143681) Human Recombinant Protein
TP326807M 100 µg

Glutathione S Transferase kappa 1 (GSTK1) (NM_001143681) Human Recombinant Protein

Sign In for Pricing
View Details
BstF5I, 200U
RE1218 200 U

BstF5I, 200U

Sign In for Pricing
View Details
Cell Navigator® Lysosome Staining Kit *Deep Red Fluorescence*
22659-AAT 500 Tests

Cell Navigator® Lysosome Staining Kit *Deep Red Fluorescence*

Sign In for Pricing
View Details
2,3-Diphenyl-5,8-diaminopyrazino[2,3-d]pyridazine
TRC-D489500-250MG 250 mg

2,3-Diphenyl-5,8-diaminopyrazino[2,3-d]pyridazine

Sign In for Pricing
View Details