Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CST4 Antibody - N-terminal region : HRP (ARP41986_T100-HRP)

Product Specifications

Gene Name

Cystatin S

Gene Aliases

MGC71923

Gene ID

1472

Swiss Prot

P01036

Accession Number

NP_001890

Host

Rabbit

Reactivity

Human

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human CST4

Target

The cystatin superfamily encompasses proteins that contain multiple cystatin-like sequences. Some of the members are active cysteine protease inhibitors, while others have lost or perhaps never acquired this inhibitory activity. There are three inhibitory families in the superfamily, including the type 1 cystatins (stefins), type 2 cystatins and the kininogens. The type 2 cystatin proteins are a class of cysteine proteinase inhibitors found in a variety of human fluids and secretions. The protein is an S-type cystatin, based on its high level of expression in saliva, tears and seminal plasma. The specific role in these fluids is unclear but antibacterial and antiviral activity is present, consistent with a protective function.The cystatin superfamily encompasses proteins that contain multiple cystatin-like sequences. Some of the members are active cysteine protease inhibitors, while others have lost or perhaps never acquired this inhibitory activity. There are three inhibitory families in the superfamily, including the type 1 cystatins (stefins), type 2 cystatins and the kininogens. The type 2 cystatin proteins are a class of cysteine proteinase inhibitors found in a variety of human fluids and secretions. The cystatin locus on chromosome 20 contains the majority of the type 2 cystatin genes and pseudogenes. This gene is located in the cystatin locus and encodes a type 2 salivary cysteine peptidase inhibitor. The protein is an S-type cystatin, based on its high level of expression in saliva, tears and seminal plasma. The specific role in these fluids is unclear but antibacterial and antiviral activity is present, consistent with a protective function.

Partner Proteins

UBC

Clonality

Polyclonal

Conjugation

HRP: Horseradish Peroxidase

Type

Polyclonal Antibody

Applications

WB

Sample Type

CST4 is supported by BioGPS gene expression data to be expressed in HepG2

Concentration

0.5 mg/ml

Homology

Human: 100%

Format

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Reconstitution

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Molecular Weight

16kDa

References & Citations

Dickinson, D.P., (2002) DNA Cell Biol. 21 (1), 47-65

Shipping Conditions

Wet Ice

Protein Length

141

NCBI Gene Symbol

CST4

NCBI GB Accession Number

CST4

Host or Source

Rabbit

Protein Name

Cystatin-S

Nucleotide Accession Number

NM_001899

Peptide Sequence

MARPLCTLLLLMATLAGALASSSKEENRIIPGGIYDADLNDEWVQRALHF

More Discoveries

Explore Other Products

Browse additional items from our catalog

CALCRL, ID (CALCRL, CGRPR, Calcitonin gene-related peptide type 1 receptor, Calcitonin receptor-like receptor) (MaxLight 750) discontinued
033147-ML750 100 µL

CALCRL, ID (CALCRL, CGRPR, Calcitonin gene-related peptide type 1 receptor, Calcitonin receptor-like receptor) (MaxLight 750) discontinued

Sign In for Pricing
View Details
Recombinant Human Tropomyosin α-3 Chain/TPM3 Protein
E53A05320 50 µg

Recombinant Human Tropomyosin α-3 Chain/TPM3 Protein

Sign In for Pricing
View Details
Rat Growth Differentiation Factor 5 (GDF5) ELISA Kit
RD-GDF5-Ra-96Tests 96 Tests

Rat Growth Differentiation Factor 5 (GDF5) ELISA Kit

Sign In for Pricing
View Details
8-Hydroxy Nevirapine
440151-01 5 mg

8-Hydroxy Nevirapine

Sign In for Pricing
View Details
8-Hydroxy Nevirapine
440151-02 10 mg

8-Hydroxy Nevirapine

Sign In for Pricing
View Details
Fbxo36 (NM_001108804) Rat Tagged ORF Clone Lentiviral Particle
RR203096L4V 200 µL

Fbxo36 (NM_001108804) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details