Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ADH1A Antibody - N-terminal region : FITC (ARP41784_P050-FITC)

Product Specifications

Gene Name

Alcohol dehydrogenase 1A (class I), alpha polypeptide

Gene Aliases

ADH1

Gene ID

124

Swiss Prot

P07327

Accession Number

NP_000658

Host

Rabbit

Reactivity

Human, Dog

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ADH1A

Target

ADH1A is class I alcohol dehydrogenase, alpha subunit, which is a member of the alcohol dehydrogenase family. Members of this enzyme family metabolize a wide variety of substrates, including ethanol, retinol, other aliphatic alcohols, hydroxysteroids, and lipid peroxidation products. Class I alcohol dehydrogenase, consisting of several homo- and heterodimers of alpha, beta, and gamma subunits, exhibits high activity for ethanol oxidation and plays a major role in ethanol catabolism. Three genes encoding alpha, beta and gamma subunits are tandemly organized in a genomic segment as a gene cluster. This gene is monomorphic and predominant in fetal and infant livers, whereas the genes encoding beta and gamma subunits are polymorphic and strongly expressed in adult livers. This gene encodes class I alcohol dehydrogenase, alpha subunit, which is a member of the alcohol dehydrogenase family. Members of this enzyme family metabolize a wide variety of substrates, including ethanol, retinol, other aliphatic alcohols, hydroxysteroids, and lipid peroxidation products. Class I alcohol dehydrogenase, consisting of several homo- and heterodimers of alpha, beta, and gamma subunits, exhibits high activity for ethanol oxidation and plays a major role in ethanol catabolism. Three genes encoding alpha, beta and gamma subunits are tandemly organized in a genomic segment as a gene cluster. This gene is monomorphic and predominant in fetal and infant livers, whereas the genes encoding beta and gamma subunits are polymorphic and strongly expressed in adult livers. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Partner Proteins

HADH; CSNK2A2; ADH1A

Clonality

Polyclonal

Conjugation

FITC: Fluorescein Isothiocyanate

Type

Polyclonal Antibody

Applications

WB

Purification

Affinity Purified

Concentration

0.5 mg/ml

Homology

Dog: 79%; Human: 100%

Format

Liquid. Purified antibody supplied in 1x PBS buffer.

Reconstitution

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Molecular Weight

40kDa

References & Citations

Ikeda, S., (2008) Am. J. Gastroenterol. 103 (6), 1476-1487

Shipping Conditions

Wet Ice

Protein Length

375

NCBI Gene Symbol

ADH1A

NCBI GB Accession Number

ADH1A

Host or Source

Rabbit

Protein Name

Alcohol dehydrogenase 1A

Nucleotide Accession Number

NM_000667

Peptide Sequence

ESNYCLKNDVSNPQGTLQDGTSRFTCRRKPIHHFLGISTFSQYTVVDENA

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Pig Nuclear receptor subfamily 6 group A member 1 (NR6A1)
MBS962609-01 0.02 mg (E-Coli)

Recombinant Pig Nuclear receptor subfamily 6 group A member 1 (NR6A1)

Sign In for Pricing
View Details
Recombinant Pig Nuclear receptor subfamily 6 group A member 1 (NR6A1)
MBS962609-02 0.02 mg (Yeast)

Recombinant Pig Nuclear receptor subfamily 6 group A member 1 (NR6A1)

Sign In for Pricing
View Details
Recombinant Pig Nuclear receptor subfamily 6 group A member 1 (NR6A1)
MBS962609-03 0.1 mg (E-Coli)

Recombinant Pig Nuclear receptor subfamily 6 group A member 1 (NR6A1)

Sign In for Pricing
View Details
Recombinant Pig Nuclear receptor subfamily 6 group A member 1 (NR6A1)
MBS962609-04 0.1 mg (Yeast)

Recombinant Pig Nuclear receptor subfamily 6 group A member 1 (NR6A1)

Sign In for Pricing
View Details
Recombinant Pig Nuclear receptor subfamily 6 group A member 1 (NR6A1)
MBS962609-05 0.02 mg (Baculovirus)

Recombinant Pig Nuclear receptor subfamily 6 group A member 1 (NR6A1)

Sign In for Pricing
View Details
Recombinant Pig Nuclear receptor subfamily 6 group A member 1 (NR6A1)
MBS962609-06 0.02 mg (Mammalian-Cell)

Recombinant Pig Nuclear receptor subfamily 6 group A member 1 (NR6A1)

Sign In for Pricing
View Details