Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ABCB4 Antibody - N-terminal region : FITC (ARP41741_P050-FITC)

Product Specifications

Gene Name

ATP-binding cassette, sub-family B (MDR/TAP), member 4

Gene Aliases

GBD1, ICP3, MDR2, MDR3, PGY3, ABC21, MDR2/3, PFIC-3

Gene ID

5244

Swiss Prot

A4D1D4

Accession Number

NP_000434

Host

Rabbit

Reactivity

Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Sheep

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ABCB4

Target

ABCB4, a membrane-associated protein, is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. This protein is a member of the MDR/TAP subfamily. Members of the MDR/TAP subfamily are involved in multidrug resistance as well as antigen presentation. ABCB4 is a full transporter and member of the p-glycoprotein family of membrane proteins with phosphatidylcholine as its substrate. The function of this protein has not yet been determined; however, it may involve transport of phospholipids from liver hepatocytes into bile.The membrane-associated protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White) . This protein is a member of the MDR/TAP subfamily. Members of the MDR/TAP subfamily are involved in multidrug resistance as well as antigen presentation. This gene encodes a full transporter and member of the p-glycoprotein family of membrane proteins with phosphatidylcholine as its substrate. The function of this protein has not yet been determined; however, it may involve transport of phospholipids from liver hepatocytes into bile. Alternative splicing of this gene results in several products of undetermined function.

Partner Proteins

PIGY; TESK1; HAX1

Clonality

Polyclonal

Conjugation

FITC: Fluorescein Isothiocyanate

Type

Polyclonal Antibody

Applications

WB

Purification

Affinity Purified

Concentration

0.5 mg/ml

Homology

Cow: 86%; Dog: 77%; Guinea Pig: 77%; Horse: 77%; Human: 100%; Mouse: 100%; Pig: 93%; Rabbit: 100%; Rat: 100%; Sheep: 77%

Format

Liquid. Purified antibody supplied in 1x PBS buffer.

Reconstitution

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Molecular Weight

141kDa

References & Citations

Floreani, A., (2008) Dig Liver Dis 40 (5), 366-370

Shipping Conditions

Wet Ice

Protein Length

1279

NCBI Gene Symbol

ABCB4

NCBI GB Accession Number

ABCB4

Host or Source

Rabbit

Protein Name

Multidrug resistance protein 3

Nucleotide Accession Number

NM_000443

Peptide Sequence

AGAVAEEALGAIRTVIAFGGQNKELERYQKHLENAKEIGIKKAISANISM

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Anti-Mouse IgG2A Phycoerythrin MAb (Cl 344701)
F0129 100 Tests

Rat Anti-Mouse IgG2A Phycoerythrin MAb (Cl 344701)

Sign In for Pricing
View Details
MAGEE2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K1256708 1.0 µg DNA

MAGEE2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Magic™ Membrane Protein Human MBOAT1 (Membrane bound O-acyltransferase domain containing 1) Full Length
MPC3068K Each

Magic™ Membrane Protein Human MBOAT1 (Membrane bound O-acyltransferase domain containing 1) Full Length

Sign In for Pricing
View Details
HERC4 (NM_001278185) Human Untagged Clone
SC337744 10 µg

HERC4 (NM_001278185) Human Untagged Clone

Sign In for Pricing
View Details
Freeze box, 81 place, cardboard
3091-1 1 Each

Freeze box, 81 place, cardboard

Sign In for Pricing
View Details
Factor IX (B-3) AC
sc-377187 AC 500 µg/mL - 25% ag

Factor IX (B-3) AC

Sign In for Pricing
View Details