Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TECK/CCL25, Human

TECK/CCL25 Protein, Human is a CC chemokine that binds to the chemokine receptor CCR9 and is involved in the development of T cells and cell migration to the small intestine, as well as a variety of inflammatory diseases and promotes inflammatory responses. It has chemotactic effects on thymocytes, macrophages and dendritic cells. TECK/CCL25 Protein, Human is a recombinant human TECK/CCL25 (Q24-L150) protein expressed byE. coli[1][2].

Product Specifications

Product Name Alternative

TECK/CCL25 Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Applications

COVID-19-immunoregulation

Assay Protocol

https://www.medchemexpress.com/cytokines/teck-ccl25-protein-human.html

Purity

97.00

Smiles

MQGVFEDCCLAYHYPIGWAVLRRAWTYRIQEVSGSCNLPAAIFYLPKRHRKVCGNPKSREVQRAMKLLDARNKVFAKLHHNTQTFQAGPHAVKKLSSGNSKLSSSKFSNPISSSKRNVSLLISANSGL

Molecular Formula

6370 (Gene_ID) O15444-1 (Q24-L150) (Accession)

Molecular Weight

Approximately 14.3 kDa

References & Citations

[1]Marcus Svensson, et al. CCL25 mediates the localization of recently activated CD8alphabeta (+) lymphocytes to the small-intestinal mucosa. J Clin Invest. 2002 Oct;110 (8) :1113-21.|[2]Xue Wu, et al. The Roles of CCR9/CCL25 in Inflammation and Inflammation-Associated Diseases. Front Cell Dev Biol. 2021 Aug 19;9:686548.|[3]Erica L Johnson, et al. CCL25-CCR9 interaction modulates ovarian cancer cell migration, metalloproteinase expression, and invasion. World J Surg Oncol. 2010 Jul 22;8:62.|[4]Crystal Johnson-Holiday, et al. CCR9-CCL25 interactions promote cisplatin resistance in breast cancer cell through Akt activation in a PI3K-dependent and FAK-independent fashion. World J Surg Oncol. 2011 May 3;9:46.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Psenen Mouse Gene Knockout Kit (CRISPR)
KN514073 1 Kit

Psenen Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
NANA Hexamer, [Neu5Ac a(2,8)Neu5Ac]3
C-7007-5 5 mg

NANA Hexamer, [Neu5Ac a(2,8)Neu5Ac]3

Sign In for Pricing
View Details
Alkaline Phosphatase (ALPL) Rabbit Monoclonal Antibody
TA422451 100 µL

Alkaline Phosphatase (ALPL) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Recombinant Mouse SerpinB8 Protein (His Tag)
PKSM040799 100 µg

Recombinant Mouse SerpinB8 Protein (His Tag)

Sign In for Pricing
View Details
Bacitracin (>80%)
TRC-B106500-5G 5 g

Bacitracin (>80%)

Sign In for Pricing
View Details
Recombinant Mouse B-cell Receptor CD22/Siglec-2/CD22 (C-6His)
PKSM041423-01 10 µg

Recombinant Mouse B-cell Receptor CD22/Siglec-2/CD22 (C-6His)

Sign In for Pricing
View Details