Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TECK/CCL25, Human

TECK/CCL25 Protein, Human is a CC chemokine that binds to the chemokine receptor CCR9 and is involved in the development of T cells and cell migration to the small intestine, as well as a variety of inflammatory diseases and promotes inflammatory responses. It has chemotactic effects on thymocytes, macrophages and dendritic cells. TECK/CCL25 Protein, Human is a recombinant human TECK/CCL25 (Q24-L150) protein expressed byE. coli[1][2].

Product Specifications

Product Name Alternative

TECK/CCL25 Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Applications

COVID-19-immunoregulation

Assay Protocol

https://www.medchemexpress.com/cytokines/teck-ccl25-protein-human.html

Purity

97.00

Smiles

MQGVFEDCCLAYHYPIGWAVLRRAWTYRIQEVSGSCNLPAAIFYLPKRHRKVCGNPKSREVQRAMKLLDARNKVFAKLHHNTQTFQAGPHAVKKLSSGNSKLSSSKFSNPISSSKRNVSLLISANSGL

Molecular Formula

6370 (Gene_ID) O15444-1 (Q24-L150) (Accession)

Molecular Weight

Approximately 14.3 kDa

References & Citations

[1]Marcus Svensson, et al. CCL25 mediates the localization of recently activated CD8alphabeta (+) lymphocytes to the small-intestinal mucosa. J Clin Invest. 2002 Oct;110 (8) :1113-21.|[2]Xue Wu, et al. The Roles of CCR9/CCL25 in Inflammation and Inflammation-Associated Diseases. Front Cell Dev Biol. 2021 Aug 19;9:686548.|[3]Erica L Johnson, et al. CCL25-CCR9 interaction modulates ovarian cancer cell migration, metalloproteinase expression, and invasion. World J Surg Oncol. 2010 Jul 22;8:62.|[4]Crystal Johnson-Holiday, et al. CCR9-CCL25 interactions promote cisplatin resistance in breast cancer cell through Akt activation in a PI3K-dependent and FAK-independent fashion. World J Surg Oncol. 2011 May 3;9:46.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

DNMT3A Rabbit Polyclonal Antibody
AP11049PU-N 400 µL

DNMT3A Rabbit Polyclonal Antibody

Ask
View Details
Lentiviral human CDX1 sgRNA gene knockout kit - Lentiviral human CDX1 sgRNA gene knockout kit (100)
GTR15375451 1 Vial

Lentiviral human CDX1 sgRNA gene knockout kit - Lentiviral human CDX1 sgRNA gene knockout kit (100)

Ask
View Details
ISCU Human qPCR Template Standard (NM_014301)
HK210181 1 Kit

ISCU Human qPCR Template Standard (NM_014301)

Ask
View Details
GCSF Receptor (CSF3R) Human qPCR Primer Pair (NM_156039)
HP227564 200 Reactions

GCSF Receptor (CSF3R) Human qPCR Primer Pair (NM_156039)

Ask
View Details
PROK Tritirachium album
32-6900-20 20 mg

PROK Tritirachium album

Ask
View Details