Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CA4 Antibody - C-terminal region : HRP (ARP41422_P050-HRP)

Product Specifications

Gene Name

Carbonic anhydrase IV

Gene Aliases

CAIV, Car4, RP17

Gene ID

762

Swiss Prot

P22748

Accession Number

NP_000708

Host

Rabbit

Reactivity

Human, Mouse, Rat, Cow, Guinea Pig, Horse, Rabbit

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human CA4

Target

Carbonic anhydrases (CAs) are a large family of zinc metalloenzymes that catalyze the reversible hydration of carbon dioxide. They participate in a variety of biological processes, including respiration, calcification, acid-base balance, bone resorption, and the formation of aqueous humor, cerebrospinal fluid, saliva, and gastric acid. They show extensive diversity in tissue distribution and in their subcellular localization. CA4 is a glycosylphosphatidyl-inositol-anchored membrane isozyme expressed on the luminal surfaces of pulmonary (and certain other) capillaries and of proximal renal tubules. Its exact function is not known, however, it may have a role in inherited renal abnormalities of bicarbonate transport.Carbonic anhydrases (CAs) are a large family of zinc metalloenzymes that catalyze the reversible hydration of carbon dioxide. They participate in a variety of biological processes, including respiration, calcification, acid-base balance, bone resorption, and the formation of aqueous humor, cerebrospinal fluid, saliva, and gastric acid. They show extensive diversity in tissue distribution and in their subcellular localization. CA IV is a glycosylphosphatidyl-inositol-anchored membrane isozyme expressed on the luminal surfaces of pulmonary (and certain other) capillaries and of proximal renal tubules. Its exact function is not known, however, it may have a role in inherited renal abnormalities of bicarbonate transport.

Partner Proteins

PIH1D1; PRDX2; Htt; SLC4A4; SLC4A1; SLC4A3

Clonality

Polyclonal

Conjugation

HRP: Horseradish Peroxidase

Type

Polyclonal Antibody

Applications

WB, IHC

Purification

Affinity Purified

Concentration

0.5 mg/ml

Homology

Cow: 83%; Guinea Pig: 92%; Horse: 83%; Human: 100%; Mouse: 85%; Rabbit: 85%; Rat: 85%

Format

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Reconstitution

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Molecular Weight

34kDa

References & Citations

Yang, Z., (2005) Hum. Mol. Genet. 14 (2), 255-265

Shipping Conditions

Wet Ice

Protein Length

312

NCBI Gene Symbol

CA4

NCBI GB Accession Number

CA4

Host or Source

Rabbit

Protein Name

Carbonic anhydrase 4

Nucleotide Accession Number

NM_000717

Peptide Sequence

AFSQKLYYDKEQTVSMKDNVRPLQQLGQRTVIKSGAPGRPLPWALPALLG

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal p57 Kip2 Antibody (SPM308) [Alexa Fluor 350]
NBP2-47765AF350 0.1 mL

Mouse Monoclonal p57 Kip2 Antibody (SPM308) [Alexa Fluor 350]

Sign In for Pricing
View Details
Rabbit Calretinin (CR) ELISA Kit
EIA05422Rb 1 Kit

Rabbit Calretinin (CR) ELISA Kit

Sign In for Pricing
View Details
HRH3 (Histamine H3 Receptor, H3R, HH3R, G-protein Coupled Receptor 97, GPCR97) (MaxLight 550) discontinued
217441-ML550 100 µL

HRH3 (Histamine H3 Receptor, H3R, HH3R, G-protein Coupled Receptor 97, GPCR97) (MaxLight 550) discontinued

Sign In for Pricing
View Details
SPI1 Antibody, mAb, Rabbit
A04568-100 100 µL

SPI1 Antibody, mAb, Rabbit

Sign In for Pricing
View Details
IPPK Knockout HEK293T Polyclonal Cells
ARG38027 1 Million

IPPK Knockout HEK293T Polyclonal Cells

Sign In for Pricing
View Details
Varicella Zoster Virus (VZV) Antibody
abx415760 0.1 mg

Varicella Zoster Virus (VZV) Antibody

Sign In for Pricing
View Details