Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CYP1A1 Antibody - middle region : Biotin (ARP41404_P050-Biotin)

Product Specifications

Gene Name

Cytochrome P450, family 1, subfamily A, polypeptide 1

Gene Aliases

AHH, AHRR, CP11, CYP1, CYPIA1, P1-450, P450-C, P450DX

Gene ID

1543

Swiss Prot

P04798

Accession Number

NP_000490

Host

Rabbit

Reactivity

Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep, Zebrafish

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human CYP1A1

Target

CYP1A1 is a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum and its expression is induced by some polycyclic aromatic hydrocarbons (PAHs), some of which are found in cigarette smoke. The enzyme's endogenous substrate is unknown; however, it is able to metabolize some PAHs to carcinogenic intermediates. CYP1A1 has been associated with lung cancer risk. This gene, CYP1A1, encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum and its expression is induced by some polycyclic aromatic hydrocarbons (PAHs), some of which are found in cigarette smoke. The enzyme's endogenous substrate is unknown; however, it is able to metabolize some PAHs to carcinogenic intermediates. The gene has been associated with lung cancer risk. A related family member, CYP1A2, is located approximately 25 kb away from CYP1A1 on chromosome 15. Sequence Note: The RefSeq transcript and protein were derived from genomic sequence to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on alignments. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Partner Proteins

CMTM5; CYB5A

Clonality

Polyclonal

Conjugation

Biotin

Type

Polyclonal Antibody

Applications

IHC, WB

Purification

Affinity Purified

Concentration

0.5 mg/ml

Homology

Cow: 100%; Dog: 86%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 77%

Format

Liquid. Purified antibody supplied in 1x PBS buffer.

Reconstitution

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Molecular Weight

58kDa

References & Citations

Ikeda, S., (2008) Am. J. Gastroenterol. 103 (6), 1476-1487

Shipping Conditions

Wet Ice

Protein Length

512

NCBI Gene Symbol

CYP1A1

NCBI GB Accession Number

CYP1A1

Host or Source

Rabbit

Protein Name

Cytochrome P450 1A1

Nucleotide Accession Number

NM_000499

Peptide Sequence

FKDLNEKFYSFMQKMVKEHYKTFEKGHIRDITDSLIEHCQEKQLDENANV

More Discoveries

Explore Other Products

Browse additional items from our catalog

NLRP3 (NM_001079821) Human Tagged ORF Clone
RC213623 10 µg

NLRP3 (NM_001079821) Human Tagged ORF Clone

Sign In for Pricing
View Details
Mouse Calreticulin-3 (CALR3) ELISA Kit
MBS7239797-01 48 Well

Mouse Calreticulin-3 (CALR3) ELISA Kit

Sign In for Pricing
View Details
Mouse Calreticulin-3 (CALR3) ELISA Kit
MBS7239797-02 96 Well

Mouse Calreticulin-3 (CALR3) ELISA Kit

Sign In for Pricing
View Details
Mouse Calreticulin-3 (CALR3) ELISA Kit
MBS7239797-03 5x 96 Well

Mouse Calreticulin-3 (CALR3) ELISA Kit

Sign In for Pricing
View Details
Mouse Calreticulin-3 (CALR3) ELISA Kit
MBS7239797-04 10x 96 Well

Mouse Calreticulin-3 (CALR3) ELISA Kit

Sign In for Pricing
View Details
Malate Dehydrogenase 1 (MDH1) Rat ELISA Kit
E8299 96 Tests

Malate Dehydrogenase 1 (MDH1) Rat ELISA Kit

Sign In for Pricing
View Details