Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MRPL24 Antibody - N-terminal region : Biotin (ARP41010_P050-Biotin)

Product Specifications

Gene Name

Mitochondrial ribosomal protein L24

Gene Aliases

L24mt, MRP-L18, MRP-L24

Gene ID

79590

Swiss Prot

Q96A35

Accession Number

NP_078816

Host

Rabbit

Reactivity

Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human MRPL24

Target

Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. MRPL24 is a 39S subunit protein which is more than twice the size of its E.coli counterpart (EcoL24) .Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 39S subunit protein which is more than twice the size of its E.coli counterpart (EcoL24) . Sequence analysis identified two transcript variants that encode the same protein.

Partner Proteins

TP53; AURKA; GRSF1; NPM1; MRPL21; C19orf70; MRPL45; TMEM177; MRPL44; MRPL40; MRPS5; TSR1; MRPL39; MRPL51; MRPL37; MRPL4; MRPL2; MRPL13; ERLEC1; MRPL19; TUFM; RPS15; ILF2; ABCC2; APP; CUL3; UBC; Ybx1; ICT1

Clonality

Polyclonal

Conjugation

Biotin

Type

Polyclonal Antibody

Applications

WB

Purification

Affinity Purified

Sample Type

MRPL24 is supported by BioGPS gene expression data to be expressed in 721_B

Concentration

0.5 mg/ml

Homology

Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%

Format

Liquid. Purified antibody supplied in 1x PBS buffer.

Reconstitution

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Molecular Weight

25kDa

References & Citations

Gregory, S.G., (2006) Nature 441 (7091), 315-321

Shipping Conditions

Wet Ice

Protein Length

216

NCBI Gene Symbol

MRPL24

NCBI GB Accession Number

MRPL24

Host or Source

Rabbit

Protein Name

39S ribosomal protein L24, mitochondrial

Nucleotide Accession Number

NM_024540

Peptide Sequence

RRRPVVVEPISDEDWYLFCGDTVEILEGKDAGKQGKVVQVIRQRNWVVVG

More Discoveries

Explore Other Products

Browse additional items from our catalog

Menin (MEN1) (NM_130799) Human Mutant ORF Clone
RC403603 10 µg

Menin (MEN1) (NM_130799) Human Mutant ORF Clone

Sign In for Pricing
View Details
HAX1 (NM_006118) Human Tagged Lenti ORF Clone
RC202690L2 10 µg

HAX1 (NM_006118) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Recombinant Salmonella typhi HTH-type transcriptional regulator metR (metR)
MBS1063908-01 0.02 mg (E-Coli)

Recombinant Salmonella typhi HTH-type transcriptional regulator metR (metR)

Sign In for Pricing
View Details
Recombinant Salmonella typhi HTH-type transcriptional regulator metR (metR)
MBS1063908-02 0.02 mg (Yeast)

Recombinant Salmonella typhi HTH-type transcriptional regulator metR (metR)

Sign In for Pricing
View Details
Recombinant Salmonella typhi HTH-type transcriptional regulator metR (metR)
MBS1063908-03 0.1 mg (E-Coli)

Recombinant Salmonella typhi HTH-type transcriptional regulator metR (metR)

Sign In for Pricing
View Details
Recombinant Salmonella typhi HTH-type transcriptional regulator metR (metR)
MBS1063908-04 0.1 mg (Yeast)

Recombinant Salmonella typhi HTH-type transcriptional regulator metR (metR)

Sign In for Pricing
View Details