Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PPIE Antibody - middle region : FITC (ARP40627_T100-FITC)

Product Specifications

Gene Name

Peptidylprolyl isomerase E (cyclophilin E)

Gene Aliases

CYP33, CYP-33

Gene ID

10450

Swiss Prot

Q9UNP9

Accession Number

NP_006103

Host

Rabbit

Reactivity

Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Sheep, Yeast

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human PPIE

Target

PPIE is a member of the peptidyl-prolyl cis-trans isomerase (PPIase) family. PPIases catalyze the cis-trans isomerization of proline imidic peptide bonds in oligopeptides and accelerate the folding of proteins. This protein contains a highly conserved cyclophilin (CYP) domain as well as an RNA-binding domain. It was shown to possess PPIase and protein folding activities and also exhibit RNA-binding activity. Three alternatively spliced transcript variants encoding distinct isoforms have been observed.The protein encoded by this gene is a member of the peptidyl-prolyl cis-trans isomerase (PPIase) family. PPIases catalyze the cis-trans isomerization of proline imidic peptide bonds in oligopeptides and accelerate the folding of proteins. This protein contains a highly conserved cyclophilin (CYP) domain as well as an RNA-binding domain. It was shown to possess PPIase and protein folding activities and also exhibit RNA-binding activity. Three alternatively spliced transcript variants encoding distinct isoforms have been observed.

Partner Proteins

XAB2; BMI1; UBC; EIF4A3; MAGOH; SF3A2; HHV8GK18_gp81; SUMO2; Prpf8; Cdc5l; Snw1; KMT2A; PHYHIP

Clonality

Polyclonal

Conjugation

FITC: Fluorescein Isothiocyanate

Type

Polyclonal Antibody

Applications

IHC, WB

Sample Type

PPIE is strongly supported by BioGPS gene expression data to be expressed in K562

Concentration

0.5 mg/ml

Homology

Cow: 100%; Dog: 100%; Guinea Pig: 86%; Horse: 100%; Human: 100%; Mouse: 93%; Pig: 100%; Rabbit: 100%; Rat: 93%; Sheep: 100%; Yeast: 100%

Format

Liquid. Purified antibody supplied in 1x PBS buffer.

Reconstitution

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Molecular Weight

33kDa

References & Citations

Fair, K., (2001) Mol. Cell. Biol. 21 (10), 3589-3597

Shipping Conditions

Wet Ice

Protein Length

301

NCBI Gene Symbol

PPIE

NCBI GB Accession Number

PPIE

Host or Source

Rabbit

Protein Name

Peptidyl-prolyl cis-trans isomerase E

Nucleotide Accession Number

NM_006112

Peptide Sequence

KKFSGKTLEENKEEEGSEPPKAETQEGEPIAKKARSNPQVYMDIKIGNKP

More Discoveries

Explore Other Products

Browse additional items from our catalog

QPRT, CT (QPRT, Nicotinate-nucleotide pyrophosphorylase [carboxylating], Quinolinate phosphoribosyltransferase [decarboxylating]) (MaxLight 750)
MBS6339446-01 0.1 mL

QPRT, CT (QPRT, Nicotinate-nucleotide pyrophosphorylase [carboxylating], Quinolinate phosphoribosyltransferase [decarboxylating]) (MaxLight 750)

Sign In for Pricing
View Details
QPRT, CT (QPRT, Nicotinate-nucleotide pyrophosphorylase [carboxylating], Quinolinate phosphoribosyltransferase [decarboxylating]) (MaxLight 750)
MBS6339446-02 5x 0.1 mL

QPRT, CT (QPRT, Nicotinate-nucleotide pyrophosphorylase [carboxylating], Quinolinate phosphoribosyltransferase [decarboxylating]) (MaxLight 750)

Sign In for Pricing
View Details
Ketamine (4E2) Monoclonal Antibody, PerCP-Cy5.5 Conjugated
bsm-2069M-PerCP-Cy5.5 100 µL

Ketamine (4E2) Monoclonal Antibody, PerCP-Cy5.5 Conjugated

Sign In for Pricing
View Details
Anti-eIF4ENIF1 Polyclonal Antibody
MF-0150728-01 50 µL

Anti-eIF4ENIF1 Polyclonal Antibody

Sign In for Pricing
View Details
Anti-eIF4ENIF1 Polyclonal Antibody
MF-0150728-02 100 µL

Anti-eIF4ENIF1 Polyclonal Antibody

Sign In for Pricing
View Details
Anti-eIF4ENIF1 Polyclonal Antibody
MF-0150728-03 200 µL

Anti-eIF4ENIF1 Polyclonal Antibody

Sign In for Pricing
View Details