Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CPNE1 Antibody - middle region : Biotin (ARP40503_P050-Biotin)

Product Specifications

Gene Name

Copine I

Gene Aliases

CPN1, COPN1

Gene ID

8904

Swiss Prot

Q99829

Accession Number

NP_003906

Host

Rabbit

Reactivity

Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Sheep, Zebrafish

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human CPNE1

Target

Calcium-dependent membrane-binding proteins may regulate molecular events at the interface of the cell membrane and cytoplasm. CPNE1 is a calcium-dependent protein that also contains two N-terminal type II C2 domains and an integrin A domain-like sequence in the C-terminus. However, the protein does not contain a predicted signal sequence or transmembrane domains. This protein has a broad tissue distribution and it may function in membrane trafficking. Calcium-dependent membrane-binding proteins may regulate molecular events at the interface of the cell membrane and cytoplasm. This gene encodes a calcium-dependent protein that also contains two N-terminal type II C2 domains and an integrin A domain-like sequence in the C-terminus. However, the encoded protein does not contain a predicted signal sequence or transmembrane domains. This protein has a broad tissue distribution and it may function in membrane trafficking. This gene and the gene for RNA binding motif protein 12 overlap at map location 20q11.21. Sequence analysis identified multiple alternatively spliced variants in the 5' UTR. All variants encode the same protein.

Partner Proteins

UBC; BAG3; BUB3; STK3; FN1; LIG4; TIMM13; TTLL12; ST13; PYGB; ARRB2; SUMO2; UIMC1; HNRNPH1; UBE2O; WTAP; MYCBP; PITPNM2; CCDC22; BCOR; CPNE4; CPNE1; UBE2M; PDCD6; PPP5C; SPTBN1; RDX; MAP2K1; SKIL; ACTB; Cdc42bpb; Etl4; Cenpf; Mycbp2; Alg2; Nono

Clonality

Polyclonal

Conjugation

Biotin

Type

Polyclonal Antibody

Applications

WB

Purification

Affinity Purified

Sample Type

CPNE1 is supported by BioGPS gene expression data to be expressed in HeLa

Concentration

0.5 mg/ml

Homology

Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 91%; Pig: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 93%

Format

Liquid. Purified antibody supplied in 1x PBS buffer.

Reconstitution

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Molecular Weight

59kDa

References & Citations

Ma, J., (2007) Atherosclerosis 191 (1), 63-72

Shipping Conditions

Wet Ice

Protein Length

537

NCBI Gene Symbol

CPNE1

NCBI GB Accession Number

CPNE1

Host or Source

Rabbit

Protein Name

Copine-1

Nucleotide Accession Number

NM_003915

Peptide Sequence

VQCSDYDSDGSHDLIGTFHTSLAQLQAVPAEFECIHPEKQQKKKSYKNSG

More Discoveries

Explore Other Products

Browse additional items from our catalog

Geranylgeranyl Diphosphate Synthase 1 (GGPS1) Antibody
abx112711 100 µL

Geranylgeranyl Diphosphate Synthase 1 (GGPS1) Antibody

Sign In for Pricing
View Details
Rat CD6 (Cluster of Differentiation 6) ValidElisa Kit
EK342206 96 Well

Rat CD6 (Cluster of Differentiation 6) ValidElisa Kit

Sign In for Pricing
View Details
DNAJA2 (DnaJ (Hsp40) Homolog, Subfamily A, Member 2, CPR3, DJ3, DJA2, DNAJ, DNJ3, HIRIP4, PRO3015, RDJ2) (FITC)
245427-FITC 100 µL

DNAJA2 (DnaJ (Hsp40) Homolog, Subfamily A, Member 2, CPR3, DJ3, DJA2, DNAJ, DNJ3, HIRIP4, PRO3015, RDJ2) (FITC)

Sign In for Pricing
View Details
Goat Ankyrin repeat and MYND domain-containing protein 2 (ANKMY2) ELISA Kit
MBS7249856-01 48 Well

Goat Ankyrin repeat and MYND domain-containing protein 2 (ANKMY2) ELISA Kit

Sign In for Pricing
View Details
Goat Ankyrin repeat and MYND domain-containing protein 2 (ANKMY2) ELISA Kit
MBS7249856-02 96 Well

Goat Ankyrin repeat and MYND domain-containing protein 2 (ANKMY2) ELISA Kit

Sign In for Pricing
View Details
Goat Ankyrin repeat and MYND domain-containing protein 2 (ANKMY2) ELISA Kit
MBS7249856-03 5x 96 Well

Goat Ankyrin repeat and MYND domain-containing protein 2 (ANKMY2) ELISA Kit

Sign In for Pricing
View Details