Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RPS14 Antibody - middle region : FITC (ARP40322_T100-FITC)

Product Specifications

Gene Name

Ribosomal protein S14

Gene Aliases

S14, EMTB

Gene ID

6208

Swiss Prot

P62263

Accession Number

NP_001020242

Host

Rabbit

Reactivity

Human, Mouse, Rat, Dog, Guinea Pig, Horse, Rabbit, Yeast, Zebrafish

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human RPS14

Target

Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. RPS14 is a ribosomal protein that is a component of the 40S subunit. The protein belongs to the S11P family of ribosomal proteins. It is located in the cytoplasm. In Chinese hamster ovary cells, mutations in this gene can lead to resistance to emetine, a protein synthesis inhibitor.Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 40S subunit. The protein belongs to the S11P family of ribosomal proteins. It is located in the cytoplasm. Transcript variants utilizing alternative transcription initiation sites have been described in the literature. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome. In Chinese hamster ovary cells, mutations in this gene can lead to resistance to emetine, a protein synthesis inhibitor. Multiple alternatively spliced transcript variants encoding the same protein have been found for this gene.

Partner Proteins

FUS; TAF9; HUWE1; CEP76; TUBG1; CEP250; TUBGCP3; CEP57; TP53; AURKA; UBC; MDM2; ZBTB1; EED; WIBG; TSR1; SERBP1; LARP1; RPS29; RPS28; RPS27; RPS26; RPS25; RPS24; RPS23; RPS20; RPS19; RPS18; RPS16; RPS15A; RPS13; RPS12; RPS10; RPS9; RPS8; RPS7; RPS6; RPS5

Clonality

Polyclonal

Conjugation

FITC: Fluorescein Isothiocyanate

Type

Polyclonal Antibody

Applications

WB

Sample Type

RPS14 is strongly supported by BioGPS gene expression data to be expressed in 721_B RPS14 is supported by BioGPS gene expression data to be expressed in HeLa, Jurkat, MCF7

Concentration

0.5 mg/ml

Homology

Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 93%; Zebrafish: 100%

Format

Liquid. Purified antibody supplied in 1x PBS buffer.

Reconstitution

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Molecular Weight

17kDa

References & Citations

Kenmochi, N., (1998) Genome Res. 8 (5), 509-523

Shipping Conditions

Wet Ice

Protein Length

151

NCBI Gene Symbol

RPS14

NCBI GB Accession Number

RPS14

Host or Source

Rabbit

Protein Name

40S ribosomal protein S14

Nucleotide Accession Number

NM_001025071

Peptide Sequence

GNRTKTPGPGAQSALRALARSGMKIGRIEDVTPIPSDSTRRKGGRRGRRL

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rdh9 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
K3240305 3x 1.0 µg

Rdh9 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
Recombinant Bovine U6 snRNA-associated Sm-like protein LSm1 (LSM1)
MBS1312384-01 0.02 mg (E-Coli)

Recombinant Bovine U6 snRNA-associated Sm-like protein LSm1 (LSM1)

Sign In for Pricing
View Details
Recombinant Bovine U6 snRNA-associated Sm-like protein LSm1 (LSM1)
MBS1312384-02 0.1 mg (E-Coli)

Recombinant Bovine U6 snRNA-associated Sm-like protein LSm1 (LSM1)

Sign In for Pricing
View Details
Recombinant Bovine U6 snRNA-associated Sm-like protein LSm1 (LSM1)
MBS1312384-03 0.02 mg (Yeast)

Recombinant Bovine U6 snRNA-associated Sm-like protein LSm1 (LSM1)

Sign In for Pricing
View Details
Recombinant Bovine U6 snRNA-associated Sm-like protein LSm1 (LSM1)
MBS1312384-04 0.1 mg (Yeast)

Recombinant Bovine U6 snRNA-associated Sm-like protein LSm1 (LSM1)

Sign In for Pricing
View Details
Recombinant Bovine U6 snRNA-associated Sm-like protein LSm1 (LSM1)
MBS1312384-05 0.02 mg (Baculovirus)

Recombinant Bovine U6 snRNA-associated Sm-like protein LSm1 (LSM1)

Sign In for Pricing
View Details