Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RBPMS Antibody - middle region : FITC (ARP40271_P050-FITC)

Product Specifications

Gene Name

RNA binding protein with multiple splicing

Gene Aliases

HERMES

Gene ID

11030

Swiss Prot

Q569H2

Accession Number

NP_001008712

Host

Rabbit

Reactivity

Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human RBPMS

Target

RBPMS is a member of the RRM family of RNA-binding proteins. The RRM domain is between 80-100 amino acids in length and family members contain one to four copies of the domain. The RRM domain consists of two short stretches of conserved sequence called RNP1 and RNP2, as well as a few highly conserved hydrophobic residues. RBPMS has a single, putative RRM domain in its N-terminus. This gene encodes a member of the RRM family of RNA-binding proteins. The RRM domain is between 80-100 amino acids in length and family members contain one to four copies of the domain. The RRM domain consists of two short stretches of conserved sequence called RNP1 and RNP2, as well as a few highly conserved hydrophobic residues. The protein encoded by this gene has a single, putative RRM domain in its N-terminus. Alternative splicing results in multiple transcript variants encoding different isoforms.

Partner Proteins

CRBN; ILF3; DOK6; ZNF385C; TEX37; WDR90; PAPD4; TOR1AIP2; ATP6V0E2; SH3RF2; DCDC2B; LOC148413; MGAT5B; SPATA8; RDH12; LOC142937; GLYCTK; NEU4; C22orf39; LRRC75A-AS1; PRR20A; ZNF488; DTX2; NAPRT; HNRNPLL; RIPPLY1; LONRF1; FBF1; C1orf94; ZC3H10; C9orf24; LI

Clonality

Polyclonal

Conjugation

FITC: Fluorescein Isothiocyanate

Type

Polyclonal Antibody

Applications

WB

Purification

Affinity Purified

Sample Type

RBPMS is supported by BioGPS gene expression data to be expressed in MCF7

Concentration

0.5 mg/ml

Homology

Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%

Format

Liquid. Purified antibody supplied in 1x PBS buffer.

Reconstitution

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Molecular Weight

24kDa

References & Citations

Lim, J., (2006) Cell 125 (4), 801-814

Shipping Conditions

Wet Ice

Protein Length

219

NCBI Gene Symbol

RBPMS

NCBI GB Accession Number

RBPMS

Host or Source

Rabbit

Protein Name

RNA binding protein with multiple splicing EMBL AAH92476.1

Nucleotide Accession Number

NM_001008712

Peptide Sequence

PASLHAQCFSPEAKPNTPVFCPLLQQIRFVSGNVFVTYQPTADQQRELPC

More Discoveries

Explore Other Products

Browse additional items from our catalog

APC-Linked Polyclonal Antibody to Fibroblast Growth Factor 22 (FGF22)
MBS2068921-01 0.1 mL

APC-Linked Polyclonal Antibody to Fibroblast Growth Factor 22 (FGF22)

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to Fibroblast Growth Factor 22 (FGF22)
MBS2068921-02 0.2 mL

APC-Linked Polyclonal Antibody to Fibroblast Growth Factor 22 (FGF22)

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to Fibroblast Growth Factor 22 (FGF22)
MBS2068921-03 0.5 mL

APC-Linked Polyclonal Antibody to Fibroblast Growth Factor 22 (FGF22)

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to Fibroblast Growth Factor 22 (FGF22)
MBS2068921-04 1 mL

APC-Linked Polyclonal Antibody to Fibroblast Growth Factor 22 (FGF22)

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to Fibroblast Growth Factor 22 (FGF22)
MBS2068921-05 5 mL

APC-Linked Polyclonal Antibody to Fibroblast Growth Factor 22 (FGF22)

Sign In for Pricing
View Details
Rat Shq1 Pre-designed siRNA Set A
SI212849A 1 Each

Rat Shq1 Pre-designed siRNA Set A

Sign In for Pricing
View Details