Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Plasminogen (PLG) (R386Q)

Product Specifications

CAS Number

9000-83-3

Gene Name

PLG

UniProt

P00747

Expression Region

20-810aa (R386Q)

Organism

Homo sapiens

Target Sequence

EPLDDYVNTQGASLFSVTKKQLGAGSIEECAAKCEEDEEFTCRAFQYHSKEQQCVIMAENRKSSIIIRMRDVVLFEKKVYLSECKTGNGKNYRGTMSKTKNGITCQKWSSTSPHRPRFSPATHPSEGLEENYCRNPDNDPQGPWCYTTDPEKRYDYCDILECEEECMHCSGENYDGKISKTMSGLECQAWDSQSPHAHGYIPSKFPNKNLKKNYCRNPDRELRPWCFTTDPNKRWELCDIPRCTTPPPSSGPTYQCLKGTGENYRGNVAVTVSGHTCQHWSAQTPHTHNRTPENFPCKNLDENYCRNPDGKRAPWCHTTNSQVRWEYCKIPSCDSSPVSTEQLAPTAPPELTPVVQDCYHGDGQSYQGTSSTTTTGKKCQSWSSMTPHRHQKTPENYPNAGLTMNYCRNPDADKGPWCFTTDPSVRWEYCNLKKCSGTEASVVAPPPVVLLPDVETPSEEDCMFGNGKGYRGKRATTVTGTPCQDWAAQEPHRHSIFTPETNPRAGLEKNYCRNPDGDVGGPWCYTTNPRKLYDYCDVPQCAAPSFDCGKPQVEPKKCPGRVVGGCVAHPHSWPWQVSLRTRFGMHFCGGTLISPEWVLTAAHCLEKSPRPSSYKVILGAHQEVNLEPHVQEIEVSRLFLEPTRKDIALLKLSSPAVITDKVIPACLPSPNYVVADRTECFITGWGETQGTFGAGLLKEAQLPVIENKVCNRYEFLNGRVQSTELCAGHLAGGTDSCQGDSGGPLVCFEKDKYILQGVTSWGLGCARPNKPGVYVRVSRFVTWIEGVMRNN

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

Baculovirus

Field of Research

Cardiovascular

Assay Type

In Stock Protein

Relevance

Plasmin dissolves the fibrin of blood clots and acts as a proteolytic factor in a variety of other processes including embryonic development, tissue remodeling, tumor invasion, and inflammation. In ovulation, weakens the walls of the Graafian follicle. It activates the urokinase-type plasminogen activator, collagenases and several complement zymogens, such as C1 and C5. Cleavage of fibronectin and laminin leads to cell detachment and apoptosis. Also cleaves fibrin, thrombospondin and von Willebrand factor. Its role in tissue remodeling and tumor invasion may be modulated by CSPG4. Binds to cells. Angiostatin is an angiogenesis inhibitor that blocks neovascularization and growth of experimental primary and metastatic tumors in vivo.

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Length

Full Length of Mature Protein

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

92.3 kDa

References & Citations

"The primary structure of human plasminogen. II. The histidine loop of human plasmin: light (B) chain active center histidine sequence." Robbins K.C., Bernabe P., Arzadon L., Summaria L. J. Biol. Chem. 248:1631-1633 (1973)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

PP1C gamma, CT (Serine/Threonine Protein Phosphatase PP1-gamma Catalytic Subunit, PP-1G, Protein Phosphatase 1C Catalytic Subunit, PPP1CC)
P9107-18D 200 µL

PP1C gamma, CT (Serine/Threonine Protein Phosphatase PP1-gamma Catalytic Subunit, PP-1G, Protein Phosphatase 1C Catalytic Subunit, PPP1CC)

Ask
View Details
Recombinant Treponema pallidum Uncharacterized protein TP_0825 (TP_0825)
MBS1178378-01 0.02 mg (E-Coli)

Recombinant Treponema pallidum Uncharacterized protein TP_0825 (TP_0825)

Ask
View Details
Recombinant Treponema pallidum Uncharacterized protein TP_0825 (TP_0825)
MBS1178378-02 0.1 mg (E-Coli)

Recombinant Treponema pallidum Uncharacterized protein TP_0825 (TP_0825)

Ask
View Details
Recombinant Treponema pallidum Uncharacterized protein TP_0825 (TP_0825)
MBS1178378-03 0.02 mg (Yeast)

Recombinant Treponema pallidum Uncharacterized protein TP_0825 (TP_0825)

Ask
View Details
Recombinant Treponema pallidum Uncharacterized protein TP_0825 (TP_0825)
MBS1178378-04 0.1 mg (Yeast)

Recombinant Treponema pallidum Uncharacterized protein TP_0825 (TP_0825)

Ask
View Details
Recombinant Treponema pallidum Uncharacterized protein TP_0825 (TP_0825)
MBS1178378-05 0.02 mg (Baculovirus)

Recombinant Treponema pallidum Uncharacterized protein TP_0825 (TP_0825)

Ask
View Details