Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MAGEA9 Antibody - middle region : FITC (ARP35768_P050-FITC)

Product Specifications

Gene Name

Melanoma antigen family A, 9

Gene Aliases

CT1.9, MAGE9

Gene ID

4108

Swiss Prot

P43362

Accession Number

NP_005356

Host

Rabbit

Reactivity

Human, Rat, Cow, Dog, Horse, Pig, Rabbit, Yeast

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human MAGEA9

Target

MAGEA9 is a member of the MAGEA gene family. The members of this family encode proteins with 50 to 80% sequence identity to each other. The promoters and first exons of the MAGEA genes show considerable variability, suggesting that the existence of this gene family enables the same function to be expressed under different transcriptional controls. The MAGEA genes are clustered at chromosomal location Xq28. They have been implicated in some hereditary disorders, such as dyskeratosis congenita. This pseudogene is a member of the cytochrome P450 gene superfamily. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. It is possible that, in rare cases, a combination of two SNPs in this gene may result in an open reading frame encoding a functional enzyme which metabolizes codeine to morphine. This locus is part of a cluster of cytochrome P450 genes on chromosome 22q13.1. This gene is a member of the MAGEA gene family. The members of this family encode proteins with 50 to 80% sequence identity to each other. The promoters and first exons of the MAGEA genes show considerable variability, suggesting that the existence of this gene family enables the same function to be expressed under different transcriptional controls. The MAGEA genes are clustered at chromosomal location Xq28. They have been implicated in some hereditary disorders, such as dyskeratosis congenita.

Partner Proteins

APPL1; UBC; EGLN1

Clonality

Polyclonal

Conjugation

FITC: Fluorescein Isothiocyanate

Type

Polyclonal Antibody

Applications

WB

Purification

Affinity Purified

Concentration

0.5 mg/ml

Homology

Cow: 77%; Dog: 79%; Horse: 79%; Human: 100%; Pig: 79%; Rabbit: 85%; Rat: 85%; Yeast: 77%

Format

Liquid. Purified antibody supplied in 1x PBS buffer.

Reconstitution

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Molecular Weight

35kDa

References & Citations

Oehlrich, N., (2005) Int. J. Cancer 117 (2), 256-264

Shipping Conditions

Wet Ice

Protein Length

315

NCBI Gene Symbol

MAGEA9

NCBI GB Accession Number

MAGEA9

Host or Source

Rabbit

Protein Name

Melanoma-associated antigen 9

Nucleotide Accession Number

NM_005365

Peptide Sequence

ALKLKVAELVHFLLHKYRVKEPVTKAEMLESVIKNYKRYFPVIFGKASEF

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fibroblast Growth Factor Receptor 2 (FGFR2) Antibody
abx402022-01 50 µL

Fibroblast Growth Factor Receptor 2 (FGFR2) Antibody

Sign In for Pricing
View Details
Fibroblast Growth Factor Receptor 2 (FGFR2) Antibody
abx402022-02 100 µL

Fibroblast Growth Factor Receptor 2 (FGFR2) Antibody

Sign In for Pricing
View Details
Timothy Grass Pollen Extract
na-3360P 1 mg

Timothy Grass Pollen Extract

Sign In for Pricing
View Details
TRIM35 (Tripartite Motif-containing Protein 35, Tripartite Motif-containing 35)
494558 100 µL

TRIM35 (Tripartite Motif-containing Protein 35, Tripartite Motif-containing 35)

Sign In for Pricing
View Details
NFIA Knockout Hela Polyclonal Cells
ARG8119 1 Million

NFIA Knockout Hela Polyclonal Cells

Sign In for Pricing
View Details
Anti-EBV-LMP1, EBS-I-025, mouse mab
691637 1 mL (100 µg/mL)

Anti-EBV-LMP1, EBS-I-025, mouse mab

Sign In for Pricing
View Details