Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FXYD5 Antibody - middle region : FITC (ARP35225_P050-FITC)

Product Specifications

Gene Name

FXYD domain containing ion transport regulator 5

Gene Aliases

RIC, IWU1, KCT1, OIT2, DYSAD, HSPC113, PRO6241

Gene ID

53827

Swiss Prot

Q96DB9

Accession Number

NP_054883

Host

Rabbit

Reactivity

Human

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human FXYD5

Target

FXYD5 is a member of a family of small membrane proteins that share a 35-amino acid signature sequence domain, beginning with the sequence PFXYD and containing 7 invariant and 6 highly conserved amino acids. The approved human gene nomenclature for the family is FXYD-domain containing ion transport regulator. Mouse FXYD5 has been termed RIC (Related to Ion Channel) . FXYD2, also known as the gamma subunit of the Na, K-ATPase, regulates the properties of that enzyme. FXYD1 (phospholemman), FXYD2 (gamma), FXYD3 (MAT-8), FXYD4 (CHIF), and FXYD5 (RIC) have been shown to induce channel activity in experimental expression systems. Transmembrane topology has been established for two family members (FXYD1 and FXYD2), with the N-terminus extracellular and the C-terminus on the cytoplasmic side of the membrane. This gene product, FXYD5, has not been characterized as a protein. This reference sequence was derived from AF161462.1 and ESTs; validated by multiple replicate ESTs and human genomic sequence. This gene encodes a member of a family of small membrane proteins that share a 35-amino acid signature sequence domain, beginning with the sequence PFXYD and containing 7 invariant and 6 highly conserved amino acids. The approved human gene nomenclature for the family is FXYD-domain containing ion transport regulator. Mouse FXYD5 has been termed RIC (Related to Ion Channel) . FXYD2, also known as the gamma subunit of the Na, K-ATPase, regulates the properties of that enzyme. FXYD1 (phospholemman), FXYD2 (gamma), FXYD3 (MAT-8), FXYD4 (CHIF), and FXYD5 (RIC) have been shown to induce channel activity in experimental expression systems. Transmembrane topology has been established for two family members (FXYD1 and FXYD2), with the N-terminus extracellular and the C-terminus on the cytoplasmic side of the membrane. This gene product, FXYD5, has not been characterized as a protein. Two transcript variants have been found for this gene, and they are both predicted to encode the same protein. [RefSeq curation by Kathleen J. Sweadner, Ph.D., sweadner@helix.mgh.harvard.edu.].

Partner Proteins

UBC

Clonality

Polyclonal

Conjugation

FITC: Fluorescein Isothiocyanate

Type

Polyclonal Antibody

Applications

WB

Purification

Affinity Purified

Concentration

0.5 mg/ml

Homology

Human: 100%

Format

Liquid. Purified antibody supplied in 1x PBS buffer.

Reconstitution

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Molecular Weight

19kDa

References & Citations

Miller, T.J. Am. J. Physiol. Lung Cell Mol. Physiol. 294 (4), L654-L664 (2008)

Shipping Conditions

Wet Ice

Protein Length

178

NCBI Gene Symbol

FXYD5

NCBI GB Accession Number

FXYD5

Host or Source

Rabbit

Protein Name

FXYD domain-containing ion transport regulator 5

Nucleotide Accession Number

NM_014164

Peptide Sequence

SERPSPSTDVQTDPQTLKPSGFHEDDPFFYDEHTLRKRGLLVAAVLFITG

More Discoveries

Explore Other Products

Browse additional items from our catalog

GENLISA™ Human A Disintegrin and Metalloproteinase with Thrombospondin Motifs 10 (ADAMTS10) ELISA
KBH3482 1x 96 Well

GENLISA™ Human A Disintegrin and Metalloproteinase with Thrombospondin Motifs 10 (ADAMTS10) ELISA

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to Cellular Repressor Of E1A Stimulated Genes 1 (CREG1)
MBS2084864-01 0.1 mL

PE-Linked Polyclonal Antibody to Cellular Repressor Of E1A Stimulated Genes 1 (CREG1)

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to Cellular Repressor Of E1A Stimulated Genes 1 (CREG1)
MBS2084864-02 0.2 mL

PE-Linked Polyclonal Antibody to Cellular Repressor Of E1A Stimulated Genes 1 (CREG1)

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to Cellular Repressor Of E1A Stimulated Genes 1 (CREG1)
MBS2084864-03 0.5 mL

PE-Linked Polyclonal Antibody to Cellular Repressor Of E1A Stimulated Genes 1 (CREG1)

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to Cellular Repressor Of E1A Stimulated Genes 1 (CREG1)
MBS2084864-04 1 mL

PE-Linked Polyclonal Antibody to Cellular Repressor Of E1A Stimulated Genes 1 (CREG1)

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to Cellular Repressor Of E1A Stimulated Genes 1 (CREG1)
MBS2084864-05 5 mL

PE-Linked Polyclonal Antibody to Cellular Repressor Of E1A Stimulated Genes 1 (CREG1)

Sign In for Pricing
View Details