What sizes are available for OTX1 Antibody - middle region : HRP (ARP32396_P050-HRP)?

OTX1 Antibody - middle region : HRP (ARP32396_P050-HRP) is available in the following size(s): 100 µL.

Is OTX1 Antibody - middle region : HRP (ARP32396_P050-HRP) in stock?

OTX1 Antibody - middle region : HRP (ARP32396_P050-HRP) is currently made to order / not held in immediate stock. Contact us for lead time.

How many freeze-thaw cycles can this product tolerate?

We recommend aliquoting the product upon receipt to avoid repeated freeze-thaw cycles, which can reduce activity and stability. This is your responsibility once the product has been delivered.

Is antigen retrieval required for IHC with this antibody?

Recommended antigen retrieval methods, where applicable, are listed on the datasheet under the IHC protocol section.

What temperature does this product ship at?

Shipping temperature is chosen based on the product’s stability needs, ranging from ambient to dry ice, and is indicated on the product page. Any related shipping fee is shown clearly in your quotation.

OTX1 Antibody - middle region : HRP (ARP32396_P050-HRP)

Q: What is the catalog number for OTX1 Antibody - middle region : HRP (ARP32396_P050-HRP)?

The catalog number for OTX1 Antibody - middle region : HRP (ARP32396_P050-HRP) is ARP32396_P050-HRP.

Selected Variant

ARP32396_P050-HRP

Size: 100 µL

Product Specifications

Gene Name

Orthodenticle homeobox 1

Gene Aliases

FLJ38361, MGC15736

Gene ID

5013

Swiss Prot

P32242

Accession Number

NP_055377

Host

Rabbit

Reactivity

Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human OTX1

Target

OTX1 is a member of the bicoid sub-family of homeodomain-containing transcription factors. OTX1 acts as a transcription factor and may play a role in brain and sensory organ development. A similar protein in mice is required for proper brain and sensory organ development and can cause epilepsy.This gene encodes a member of the bicoid sub-family of homeodomain-containing transcription factors. The encoded protein acts as a transcription factor and may play a role in brain and sensory organ development. A similar protein in mice is required for proper brain and sensory organ development and can cause epilepsy.

Partner Proteins

KRTAP10-3; KRTAP10-8; KRTAP10-5; KRTAP10-11; KRTAP10-1; KRTAP10-9; KRTAP12-2; LCE2D; LCE2A; LCE1B; LCE4A; MGAT5B; KRTAP3-3; KRTAP4-2; KRTAP4-7; KRTAP9-4; KRTAP9-2; KRTAP4-11; GEMIN8P4; KRTAP5-6; KRTAP26-1; KRTAP12-4; KRTAP3-2; KCNK16; KRTAP4-12; RGS17; RB

Clonality

Polyclonal

Conjugation

HRP: Horseradish Peroxidase

Type

Polyclonal Antibody

Applications

Purification

Affinity Purified

Concentration

0.5 mg/ml

Homology

Cow: 86%; Dog: 93%; Guinea Pig: 86%; Horse: 93%; Human: 100%; Mouse: 93%; Pig: 93%; Rabbit: 93%; Rat: 93%

Format

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Reconstitution

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Molecular Weight

37kDa

References & Citations

Hillier, L.W., (2005) Nature 434 (7034), 724-731

Shipping Conditions

Wet Ice

Protein Length

354

NCBI Gene Symbol

OTX1

NCBI GB Accession Number

OTX1

Host or Source

Rabbit

Protein Name

Homeobox protein OTX1

Nucleotide Accession Number

NM_014562

Peptide Sequence

ISPGSAPASVSVPEPLAAPSNTSCMQRSVAAGAATAAASYPMSYGQGGSY

Price

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TIMP1 (Colorectal Cancer Biomarker / Marker of Lymph Node Metastasis) (rTIMP1/1710), CF640R conjugate, 0.1mg/mL

BNC401943-500 1x 500 µL