Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TBX19 Antibody - middle region : Biotin (ARP32364_P050-Biotin)

Product Specifications

Gene Name

T-box 19

Gene Aliases

TPIT, TBS19, dJ747L4.1

Gene ID

9095

Swiss Prot

O60806

Accession Number

NP_005140

Host

Rabbit

Reactivity

Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human TBX19

Target

TBX19 is a member of a phylogenetically conserved family of genes that share a common DNA-binding domain, the T-box. T-box genes encode transcription factors involved in the regulation of developmental processes. This gene is the human ortholog of mouse Tbx19/Tpit gene. Studies in mouse show that Tpit protein is present only in the two pituitary pro-opiomelanocortin (POMC) -expressing lineages, the corticotrophs and melanotrophs. Mutations in the human ortholog were found in patients with isolated deficiency of pituitary POMC-derived ACTH, suggesting an essential role for this gene in differentiation of the pituitary POMC lineage.This gene is a member of a phylogenetically conserved family of genes that share a common DNA-binding domain, the T-box. T-box genes encode transcription factors involved in the regulation of developmental processes. Mutations in this gene were found in patients with isolated deficiency of pituitary POMC-derived ACTH, suggesting an essential role for this gene in differentiation of the pituitary POMC lineage. ACTH deficiency is characterized by adrenal insufficiency symptoms such as weight loss, lack of appetite (anorexia), weakness, nausea, vomiting, and low blood pressure. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Partner Proteins

NR5A1

Clonality

Polyclonal

Conjugation

Biotin

Type

Polyclonal Antibody

Applications

WB

Purification

Affinity Purified

Concentration

0.5 mg/ml

Homology

Cow: 79%; Dog: 79%; Guinea Pig: 79%; Horse: 85%; Human: 100%; Mouse: 93%; Pig: 93%; Rabbit: 93%; Rat: 77%

Format

Liquid. Purified antibody supplied in 1x PBS buffer.

Reconstitution

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Molecular Weight

48kDa

References & Citations

Maira, M., et al., (2003) Bilodeau, S. J. Biol. Chem. 278 (47), 46523-46532

Shipping Conditions

Wet Ice

Protein Length

448

NCBI Gene Symbol

TBX19

NCBI GB Accession Number

TBX19

Host or Source

Rabbit

Protein Name

T-box transcription factor TBX19

Nucleotide Accession Number

NM_005149

Peptide Sequence

IKYNPFAKAFLDAKERNHLRDVPEAISESQHVTYSHLGGWIFSNPDGVCT

More Discoveries

Explore Other Products

Browse additional items from our catalog

TMEM231 Lentiviral Activation Particles (h)
sc-413179-LAC 200 µL

TMEM231 Lentiviral Activation Particles (h)

Sign In for Pricing
View Details
X axis step motor
1-8-031-018-12 1 Each

X axis step motor

Sign In for Pricing
View Details
Lentiviral mouse Cryba4 shRNA (UAS) - Lentiviral mouse Cryba4 shRNA (UAS, iRFP) (25)
GTR15284666 1 Vial

Lentiviral mouse Cryba4 shRNA (UAS) - Lentiviral mouse Cryba4 shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details
Anti-ARHGAP4 Antibody (N290B/3)
RHF79602 100 μg

Anti-ARHGAP4 Antibody (N290B/3)

Sign In for Pricing
View Details
VGLL2, NT (VGLL2, VITO1, Transcription cofactor vestigial-like protein 2, Protein VITO1) (MaxLight 650) discontinued
043753-ML650 100 µL

VGLL2, NT (VGLL2, VITO1, Transcription cofactor vestigial-like protein 2, Protein VITO1) (MaxLight 650) discontinued

Sign In for Pricing
View Details
Flufenamic acid 1000mg
A13333-1000 1000 mg

Flufenamic acid 1000mg

Sign In for Pricing
View Details