Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Annexin A5/ANXA5, Human

Annexin A5 Protein, Human is a 35 kDa multifunctional protein which belongs to the annexin family. Annexin A5 induces in vitro fusion and aggregation of vesicles in a Ca2+- and acidic-pH-dependent manner.Annexin A5 is accepted as an early marker of apoptosis. Annexin A5 has anti-thrombotic and anti-microbial properties[1].

Product Specifications

Product Name Alternative

Annexin A5/ANXA5 Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/annexin-a5-anxa5-protein-human.html

Purity

98.0

Smiles

AQVLRGTVTDFPGFDERADAETLRKAMKGLGTDEESILTLLTSRSNAQRQEISAAFKTLFGRDLLDDLKSELTGKFEKLIVALMKPSRLYDAYELKHALKGAGTNEKVLTEIIASRTPEELRAIKQVYEEEYGSSLEDDVVGDTSGYYQRMLVVLLQANRDPDAGIDEAQVEQDAQALFQAGELKWGTDEEKFITIFGTRSVSHLRKVFDKYMTISGFQIEETIDRETSGNLEQLLLAVVKSIRSIPAYLAETLYYAMKGAGTDDHTLIRVMVSRSEIDLFNIRKEFRKNFATSLYSMIKGDTSGDYKKALLLLCGEDD

Molecular Formula

308 (Gene_ID) P08758 (A2-D320) (Accession)

Molecular Weight

Approximately 33.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Olfr1308 Protein Vector (Mouse) (pPM-C-HA)
PV208916 500 ng

Olfr1308 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
WBP5 Lentiviral Vector (Rat) (EF1a) (pLenti-GIII-EF1a)
LV638418 1.0 µg DNA

WBP5 Lentiviral Vector (Rat) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details
Biotinylated Human TNFR1 / CD120a / TNFRSF1A (30-82) Protein, His, Avitag™ (HPLC verified)
TN1-H82E5-25ug 25 µg

Biotinylated Human TNFR1 / CD120a / TNFRSF1A (30-82) Protein, His, Avitag™ (HPLC verified)

Sign In for Pricing
View Details
Gastric Inhibitory Polypeptide
547056 200 µL

Gastric Inhibitory Polypeptide

Sign In for Pricing
View Details
Rabbit anti-Alpha-tubulin (AcK352) Antibody
MBS4511947-01 0.05 mL

Rabbit anti-Alpha-tubulin (AcK352) Antibody

Sign In for Pricing
View Details
Rabbit anti-Alpha-tubulin (AcK352) Antibody
MBS4511947-02 0.1 mL

Rabbit anti-Alpha-tubulin (AcK352) Antibody

Sign In for Pricing
View Details