Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SCF, Rat (P.pastoris)

SCF Protein, Rat (P.pastoris) is a hematopoietic cytokine, triggered by binding to its ligand c-kit, and plays an important role in hematopoiesis, spermatogenesis, and melanogenesis.

Product Specifications

Product Name Alternative

SCF Protein, Rat (P.pastoris), Rat, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/scf-protein-rat-p-pastoris.html

Purity

95.00

Smiles

QEICRNPVTDNVKDITKLVANLPNDYMITLNYVAGMDVLPSHCWLRDMVTHLSVSLTTLLDKFSNISEGLSNYSIIDKLGKIVDDLVACMEENAPKNVKESLKKPETRNFTPEEFFSIFNRSIDAFKDFMVASDTSDCVLSSTLGPEKDSRVSVTKPFMLPPVA

Molecular Formula

60427 (Gene_ID) P21581-1 (Q26-A189) (Accession)

Molecular Weight

Approximately 18.3 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Farhadi B, et al. Construction of pPIC9 Recombinant Vector Containing Human Stem Cell Factor. Adv Pharm Bull. 2013;3 (2) :303-8.|[2]Kim JY, et al. Stem cell factor is a potent endothelial permeability factor. Arterioscler Thromb Vasc Biol. 2014 Jul;34 (7) :1459-67.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tspan33 Rabbit Polyclonal Antibody
TA334092 100 µL

Tspan33 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
DEFA6 Protein Vector (Human) (pPM-C-HA)
PV012127 500 ng

DEFA6 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Mouse Monoclonal FBXW7/Cdc4 Antibody (FBOX 3a9/1) [Alexa Fluor 647]
NBP2-50403AF647 0.1 mL

Mouse Monoclonal FBXW7/Cdc4 Antibody (FBOX 3a9/1) [Alexa Fluor 647]

Sign In for Pricing
View Details
Olfr570 (NM_147110) Mouse Tagged ORF Clone
MG213298 10 µg

Olfr570 (NM_147110) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
FITC human CD15 Antibody
orb3066256-01 25 Tests

FITC human CD15 Antibody

Sign In for Pricing
View Details
FITC human CD15 Antibody
orb3066256-02 100 Tests

FITC human CD15 Antibody

Sign In for Pricing
View Details