Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ephrin-A3/EFNA3, Human (HEK293)

Ephrin-A3/EFNA3 proteins are cell surface GPI-binding ligands of Eph receptors and play a key role in regulating key cellular processes such as migration, repulsion, and adhesion during neuronal, vascular, and epithelial development. As a promiscuous binder, Ephrin-A3 binds to Eph receptors on neighboring cells, initiating contact-dependent bidirectional signaling to neighboring cells. Ephrin-A3/EFNA3 Protein, Human (HEK293) is the recombinant human-derived Ephrin-A3/EFNA3, expressed by HEK293, with tag-free.

Product Specifications

Product Name Alternative

Ephrin-A3/EFNA3 Protein, Human (HEK293), Human, HEK293

UNSPSC

12352202

Type

Reference compound

Assay Protocol

https://www.medchemexpress.com/cytokines/ephrin-a3-efna3-protein-human-hek293-tag-free.html

Smiles

QGPGGALGNRHAVYWNSSNQHLRREGYTVQVNVNDYLDIYCPHYNSSGVGPGAGPGPGGGAEQYVLYMVSRNGYRTCNASQGFKRWECNRPHAPHSPIKFSEKFQRYSAFSLGYEFHAGHEYYYISTPTHNLHWKCLRMKVFVCCASTSHSGEKPVPTLPQFTMGPNVKINVLEDFEGENPQVPKLEKSIS

Molecular Formula

1944 (Gene_ID) P52797-1 (Q23-S213) (Accession)

Molecular Weight

Approximately 25-38 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

MAPK organizer 1 Polyclonal Antibody
bs-6722R 100 µL

MAPK organizer 1 Polyclonal Antibody

Sign In for Pricing
View Details
RSV (Respiratory Syncytial Virus) (APC)
227145-APC 100 µL

RSV (Respiratory Syncytial Virus) (APC)

Sign In for Pricing
View Details
Cfc1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)
K6575208 1.0 µg DNA

Cfc1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details
AP-A Antibody (YA2164, Rabbit)
HY-P82419-01 10 µL

AP-A Antibody (YA2164, Rabbit)

Sign In for Pricing
View Details
AP-A Antibody (YA2164, Rabbit)
HY-P82419-02 50 μL

AP-A Antibody (YA2164, Rabbit)

Sign In for Pricing
View Details
AP-A Antibody (YA2164, Rabbit)
HY-P82419-03 100 µL

AP-A Antibody (YA2164, Rabbit)

Sign In for Pricing
View Details