Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TEAD4, Human (His)

TEAD4 protein is a transcription factor that plays a key role in the Hippo signaling pathway and is essential for organ size control and tumor suppression. It coordinates proliferation inhibition and apoptosis promotion through a kinase cascade involving MST1/MST2, SAV1, LATS1/2, and MOB1. TEAD4 Protein, Human (His) is the recombinant human-derived TEAD4 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

TEAD4 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tead4-protein-human-his.html

Purity

90.00

Smiles

MYGRNELIARYIKLRTGKTRTRKQVSSHIQVLARRKAREIQAKLKDQAAKDKALQSMAAMSSAQIISATAFHSSMALARGPGRPAVSGFWQGALPGQAGTSHDVKPFSQQTYAVQPPLPLPGFESPAGPAPSPSAPPAPPWQGRSVASSKLWMLEFSAFLEQQQDPDTYNKHLFVHIGQSSPSYSDPYLEAVDIRQIYDKFPEKKGGLKDLFERGPSNAFFLVKFWADLNTNIEDEGSSFYGVSSQYESPENMIITCSTKVCSFGKQVVEKVETEYARYENGHYSYRIHRSPLCEYMINFIHKLKHLPEKYMMNSVLENFTILQVVTNRDTQETLLCIAYVFEVSASEHGAQHHIYRLVKE

Molecular Formula

7004 (Gene_ID) Q15561 (M74-E434) (Accession)

Molecular Weight

Approximately 44.7 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GDAP1L1 Human Gene Knockout Kit (CRISPR)
KN400976 1 Kit

GDAP1L1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant Paxillin Antibody
RC-5852-01 50 μL

Recombinant Paxillin Antibody

Sign In for Pricing
View Details
Recombinant Paxillin Antibody
RC-5852-02 100 µL

Recombinant Paxillin Antibody

Sign In for Pricing
View Details
Recombinant Paxillin Antibody
RC-5852-03 1 mL

Recombinant Paxillin Antibody

Sign In for Pricing
View Details
MFluor™ Blue 590 SE
1161-AAT 1 mg

MFluor™ Blue 590 SE

Sign In for Pricing
View Details
PKC eta (PRKCH) (NM_006255) Human Over-expression Lysate
LY401883 100 µg

PKC eta (PRKCH) (NM_006255) Human Over-expression Lysate

Sign In for Pricing
View Details