Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TEAD4, Human (His)

TEAD4 protein is a transcription factor that plays a key role in the Hippo signaling pathway and is essential for organ size control and tumor suppression. It coordinates proliferation inhibition and apoptosis promotion through a kinase cascade involving MST1/MST2, SAV1, LATS1/2, and MOB1. TEAD4 Protein, Human (His) is the recombinant human-derived TEAD4 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

TEAD4 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tead4-protein-human-his.html

Purity

90.00

Smiles

MYGRNELIARYIKLRTGKTRTRKQVSSHIQVLARRKAREIQAKLKDQAAKDKALQSMAAMSSAQIISATAFHSSMALARGPGRPAVSGFWQGALPGQAGTSHDVKPFSQQTYAVQPPLPLPGFESPAGPAPSPSAPPAPPWQGRSVASSKLWMLEFSAFLEQQQDPDTYNKHLFVHIGQSSPSYSDPYLEAVDIRQIYDKFPEKKGGLKDLFERGPSNAFFLVKFWADLNTNIEDEGSSFYGVSSQYESPENMIITCSTKVCSFGKQVVEKVETEYARYENGHYSYRIHRSPLCEYMINFIHKLKHLPEKYMMNSVLENFTILQVVTNRDTQETLLCIAYVFEVSASEHGAQHHIYRLVKE

Molecular Formula

7004 (Gene_ID) Q15561 (M74-E434) (Accession)

Molecular Weight

Approximately 44.7 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Biotin (Hyb8), CF568 conjugate, 0.1mg/mL
BNC680400-500 1x 500 µL

Biotin (Hyb8), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fenbuconazole-d5
TRC-F246802-5MG 5 mg

Fenbuconazole-d5

Sign In for Pricing
View Details
Casq2 Mouse Gene Knockout Kit (CRISPR)
KN502574 1 Kit

Casq2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
PTH (Parathyroid Hormone) (N & C Terminal) (3H9 + PTH/1175), CF568 conjugate, 0.1mg/mL
BNC681236-100 1x 100 µL

PTH (Parathyroid Hormone) (N & C Terminal) (3H9 + PTH/1175), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant Histone H1.0 Antibody
RC-5048-01 50 μL

Recombinant Histone H1.0 Antibody

Sign In for Pricing
View Details
Recombinant Histone H1.0 Antibody
RC-5048-02 100 µL

Recombinant Histone H1.0 Antibody

Sign In for Pricing
View Details