Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TEAD4, Human (His)

TEAD4 protein is a transcription factor that plays a key role in the Hippo signaling pathway and is essential for organ size control and tumor suppression. It coordinates proliferation inhibition and apoptosis promotion through a kinase cascade involving MST1/MST2, SAV1, LATS1/2, and MOB1. TEAD4 Protein, Human (His) is the recombinant human-derived TEAD4 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

TEAD4 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tead4-protein-human-his.html

Purity

90.00

Smiles

MYGRNELIARYIKLRTGKTRTRKQVSSHIQVLARRKAREIQAKLKDQAAKDKALQSMAAMSSAQIISATAFHSSMALARGPGRPAVSGFWQGALPGQAGTSHDVKPFSQQTYAVQPPLPLPGFESPAGPAPSPSAPPAPPWQGRSVASSKLWMLEFSAFLEQQQDPDTYNKHLFVHIGQSSPSYSDPYLEAVDIRQIYDKFPEKKGGLKDLFERGPSNAFFLVKFWADLNTNIEDEGSSFYGVSSQYESPENMIITCSTKVCSFGKQVVEKVETEYARYENGHYSYRIHRSPLCEYMINFIHKLKHLPEKYMMNSVLENFTILQVVTNRDTQETLLCIAYVFEVSASEHGAQHHIYRLVKE

Molecular Formula

7004 (Gene_ID) Q15561 (M74-E434) (Accession)

Molecular Weight

Approximately 44.7 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GATA-3 (Breast and Urothelial Marker) (GATA3/2442), CF594 conjugate, 0.1mg/mL
BNC942442-100 1x 100 µL

GATA-3 (Breast and Urothelial Marker) (GATA3/2442), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ypel5 (BC025125) Mouse Tagged ORF Clone
MG200035 10 µg

Ypel5 (BC025125) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Tissue FFPE Sections, Metastasis, unknown source
CS804583 5x 5 µm

Tissue FFPE Sections, Metastasis, unknown source

Sign In for Pricing
View Details
MMP7 Antibody
KC-3896-01 50 μL

MMP7 Antibody

Sign In for Pricing
View Details
MMP7 Antibody
KC-3896-02 100 µL

MMP7 Antibody

Sign In for Pricing
View Details
MMP7 Antibody
KC-3896-03 1 mL

MMP7 Antibody

Sign In for Pricing
View Details